(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE138

MICSR_1.PE138        Location/Qualifiers
FT   CDS             258710..259990
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636478"
FT                   /orf_name="MICPUN_56710"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO61654.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG560005"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="UniParc:UPI000199A81D"
FT                   /db_xref="UniProtKB/TrEMBL:C1E115"
FT                   /transl_table=1
FT                   /translation="MSREGEAPDPPGPLPATPALCRHWARRGRCDYGDGCRFRHERVPG
FT                   DDADADDPRVSAMDGRREGATRFGRRHHARNRNKAGDFRRWLVATFGFETLASGAGVLD
FT                   VAGGKGELAFELRNLSGIPVTVVDPRPMRLERYVRRFRSGMYHRNQSPAAAKLRRPLDS
FT                   TLAAPDHLRMFLHRGVFDPARSDGERRLAAIESHRLSHATRWSRRGLVDGESAPGDGDG
FT                   DGESAPGDGVRDGANLDEAYRIPGEPVRHATMFSEIPRRRDPDADDVESDVYADVEADV
FT                   EADVDDPDAAAMTPVAMDASATADACERVFRDCSVVVGLHPDQATDAAVDLALAFGKPF
FT                   AVVPCCTYSRDFPHRRLPPGPGRPRGGGAVTTHAHLVEYLLAKAAPGTTIERDELPFEG
FT                   KNVVVYSLGDGGSELLCRAVDGLGVGE"
     MSREGEAPDP PGPLPATPAL CRHWARRGRC DYGDGCRFRH ERVPGDDADA DDPRVSAMDG        60
     RREGATRFGR RHHARNRNKA GDFRRWLVAT FGFETLASGA GVLDVAGGKG ELAFELRNLS       120
     GIPVTVVDPR PMRLERYVRR FRSGMYHRNQ SPAAAKLRRP LDSTLAAPDH LRMFLHRGVF       180
     DPARSDGERR LAAIESHRLS HATRWSRRGL VDGESAPGDG DGDGESAPGD GVRDGANLDE       240
     AYRIPGEPVR HATMFSEIPR RRDPDADDVE SDVYADVEAD VEADVDDPDA AAMTPVAMDA       300
     SATADACERV FRDCSVVVGL HPDQATDAAV DLALAFGKPF AVVPCCTYSR DFPHRRLPPG       360
     PGRPRGGGAV TTHAHLVEYL LAKAAPGTTI ERDELPFEGK NVVVYSLGDG GSELLCRAVD       420
     GLGVGE                                                                  426
//

If you have problems or comments...

PBIL Back to PBIL home page