(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE139

MICSR_1.PE139        Location/Qualifiers
FT   CDS             complement(260485..261324)
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636479"
FT                   /orf_name="MICPUN_99310"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62097.1"
FT                   /db_xref="UniParc:UPI000199A81E"
FT                   /db_xref="UniProtKB/TrEMBL:C1E116"
FT                   /transl_table=1
FT                   /translation="MASSDDDVTRPPEEGLTVSASIGPRFGNAGVWREAVANSYYAARA
FT                   DEDEISLRVAEADREARESARWREECEKERRAIAERIKARHGAYPPKPAPATPAEMDAR
FT                   RASKKAEIMRLSKRDEENKMLRARILPPHQYDGEFPEEMRKHGRVLEHGGVYADTALWR
FT                   RHEAEWEEFMETARGMSIIRKRQIPFPEAGGAALYRHLILKSIHEFNLSEEDAEKFAFR
FT                   RCAMRWHPDKVMTAVGIRLLPEEYDEVGAKCVEVFREVQEEHKNRLRLRGTLPSGCD"
     MASSDDDVTR PPEEGLTVSA SIGPRFGNAG VWREAVANSY YAARADEDEI SLRVAEADRE        60
     ARESARWREE CEKERRAIAE RIKARHGAYP PKPAPATPAE MDARRASKKA EIMRLSKRDE       120
     ENKMLRARIL PPHQYDGEFP EEMRKHGRVL EHGGVYADTA LWRRHEAEWE EFMETARGMS       180
     IIRKRQIPFP EAGGAALYRH LILKSIHEFN LSEEDAEKFA FRRCAMRWHP DKVMTAVGIR       240
     LLPEEYDEVG AKCVEVFREV QEEHKNRLRL RGTLPSGCD                              279
//

If you have problems or comments...

PBIL Back to PBIL home page