(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE14

MICSR_1.PE14         Location/Qualifiers
FT   CDS             join(27285..28396,28457..28661)
FT                   /codon_start=1
FT                   /gene_family="HOG000280651" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636019"
FT                   /gene_name="CNX1E"
FT                   /orf_name="MICPUN_79735"
FT                   /product="Molybdenum cofactor biosynthesis protein CNX1E "
FT                   /biological_process="Mo-molybdopterin cofactor biosynthetic
FT                   process"
FT                   /protein_id="ACO61591.1"
FT                   /db_xref="GO:0006777"
FT                   /db_xref="HOGENOM:HBG731522"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR020817"
FT                   /db_xref="UniParc:UPI000199AA55"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0P1"
FT                   /transl_table=1
FT                   /translation="MISMNEAVDRVISRAHPLPQESVAFVDAVGRVVAEDFVAPRPHPP
FT                   FAASVMDGYAVRSADCPGVMTLIGASRAGAPMRGSGNTSIQPGQCAYITTGAPLPPGAD
FT                   AVVPSEECRVDGGTVSIDANVDAGKWVRPVGFDIKAGETLVPAGSLVGAHEVGIVAAAG
FT                   GGEICVHRKPKLALLSTGDELAEAGEVEPDASSGRIYDANRPMLAALAKTSGVDDVLDL
FT                   GRAVDDPGALASLVARAHAEGCDVLVTSGGVSEGDRDYLKEVLLGEHGGGIEGEVHFGR
FT                   VMMKPGKPLTFAEVQSKTDCGGNKMLVFALPGNPVSAAVTFHLVVVPTLRRMMGWRDPR
FT                   LRRVHVVVSSDLKLDPERPEYHRATLDWQEHTRHLPAAHSTGKQVSSRLTSMRGAEVLM
FT                   ELPRGPGMVAKGTVVSALVIGNLSSASVQLPAISPEVVR"
     MISMNEAVDR VISRAHPLPQ ESVAFVDAVG RVVAEDFVAP RPHPPFAASV MDGYAVRSAD        60
     CPGVMTLIGA SRAGAPMRGS GNTSIQPGQC AYITTGAPLP PGADAVVPSE ECRVDGGTVS       120
     IDANVDAGKW VRPVGFDIKA GETLVPAGSL VGAHEVGIVA AAGGGEICVH RKPKLALLST       180
     GDELAEAGEV EPDASSGRIY DANRPMLAAL AKTSGVDDVL DLGRAVDDPG ALASLVARAH       240
     AEGCDVLVTS GGVSEGDRDY LKEVLLGEHG GGIEGEVHFG RVMMKPGKPL TFAEVQSKTD       300
     CGGNKMLVFA LPGNPVSAAV TFHLVVVPTL RRMMGWRDPR LRRVHVVVSS DLKLDPERPE       360
     YHRATLDWQE HTRHLPAAHS TGKQVSSRLT SMRGAEVLME LPRGPGMVAK GTVVSALVIG       420
     NLSSASVQLP AISPEVVR                                                     438
//

If you have problems or comments...

PBIL Back to PBIL home page