(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE140

MICSR_1.PE140        Location/Qualifiers
FT   CDS             263002..263742
FT                   /codon_start=1
FT                   /gene_family="HOG000200133" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636480"
FT                   /orf_name="MICPUN_107875"
FT                   /product="Predicted protein"
FT                   /function="magnesium ion binding"
FT                   /function="phosphatase activity"
FT                   /biological_process="nucleotide metabolic process "
FT                   /protein_id="ACO61655.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0009117"
FT                   /db_xref="GO:0016791"
FT                   /db_xref="InterPro:IPR009453"
FT                   /db_xref="UniParc:UPI000199A81F"
FT                   /db_xref="UniProtKB/TrEMBL:C1E117"
FT                   /transl_table=1
FT                   /translation="MIDKIIQLMEIGVHVAIVTAAGYPGDSKKFEGRLRGLLDSFKENE
FT                   LTAETRKRFSVMGGECNYLLEVNEEFELEFVDPAVWRDQPSTKNLYWYAQGEAKTKVEA
FT                   FLDRAEQFLKDEAEHLELDYEVMRKEFAVGILPQSSTVYENLEEISIGAMIELSDAEVP
FT                   YCAFNGGNDVFVDVGNKNIGLQTLMNYLGFEGHQTLHVGDRFTSTGNDSRVRDACSILW
FT                   VASPDETTFFMRLLYRDIVNARVL"
     MIDKIIQLME IGVHVAIVTA AGYPGDSKKF EGRLRGLLDS FKENELTAET RKRFSVMGGE        60
     CNYLLEVNEE FELEFVDPAV WRDQPSTKNL YWYAQGEAKT KVEAFLDRAE QFLKDEAEHL       120
     ELDYEVMRKE FAVGILPQSS TVYENLEEIS IGAMIELSDA EVPYCAFNGG NDVFVDVGNK       180
     NIGLQTLMNY LGFEGHQTLH VGDRFTSTGN DSRVRDACSI LWVASPDETT FFMRLLYRDI       240
     VNARVL                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page