(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE141

MICSR_1.PE141        Location/Qualifiers
FT   CDS             join(complement(265668..266273),c
FT                   omplement(<264888..265283))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636481"
FT                   /orf_name="MICPUN_79876"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62098.1"
FT                   /db_xref="HOGENOM:HBG609687"
FT                   /db_xref="InterPro:IPR004182"
FT                   /db_xref="UniParc:UPI000199A820"
FT                   /db_xref="UniProtKB/TrEMBL:C1E118"
FT                   /transl_table=1
FT                   /translation="MDVTGGPKSTGYAGATKAKAKSDGKDSLRKLFKLPDDEVLIEEYL
FT                   CALYKKILLQGRMYLFRNYVCFYSNVFGYQKNKVIPLKDVTIVRRAYTVKVVPNAIEIV
FT                   CNGKCEFFTSFIFPDRAYRNITNAWKECSQYAKIFAAADVDNSKVAAEMLVVPKFSSPP
FT                   SAEVAAMLGLRDGGDGGDDDDAGSKGSGPRSSGSDGPRSDDDVDDDVDDDVDVANEDDF
FT                   GERLVATSTPVPPRPSDMRTLEECVLECAVEDVFSLVWSDSAAGAFGAEDHASRGETAV
FT                   QTTKWSRHRHHGHARDLTFIAPVNASIGPKQTNCHQTQSYHACRGGALVVDTS"
     MDVTGGPKST GYAGATKAKA KSDGKDSLRK LFKLPDDEVL IEEYLCALYK KILLQGRMYL        60
     FRNYVCFYSN VFGYQKNKVI PLKDVTIVRR AYTVKVVPNA IEIVCNGKCE FFTSFIFPDR       120
     AYRNITNAWK ECSQYAKIFA AADVDNSKVA AEMLVVPKFS SPPSAEVAAM LGLRDGGDGG       180
     DDDDAGSKGS GPRSSGSDGP RSDDDVDDDV DDDVDVANED DFGERLVATS TPVPPRPSDM       240
     RTLEECVLEC AVEDVFSLVW SDSAAGAFGA EDHASRGETA VQTTKWSRHR HHGHARDLTF       300
     IAPVNASIGP KQTNCHQTQS YHACRGGALV VDTS                                   334
//

If you have problems or comments...

PBIL Back to PBIL home page