(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE142

MICSR_1.PE142        Location/Qualifiers
FT   CDS             <267775..>268128
FT                   /codon_start=1
FT                   /gene_family="HOG000035674" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636482"
FT                   /orf_name="MICPUN_73414"
FT                   /product="Predicted protein"
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO61656.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG609689"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniParc:UPI000199A821"
FT                   /db_xref="UniProtKB/TrEMBL:C1E119"
FT                   /transl_table=1
FT                   /translation="ALLESWPDFRAATDRSNRQVLAPLTRGDLVTVSALPAVAEEALFR
FT                   GCVVPALGGGPLGVIVSGMTFGALHVGGGRNAAFAAWASAVGCLYGACAVGCGDVSVAI
FT                   AAHAMANYASATMW"
     ALLESWPDFR AATDRSNRQV LAPLTRGDLV TVSALPAVAE EALFRGCVVP ALGGGPLGVI        60
     VSGMTFGALH VGGGRNAAFA AWASAVGCLY GACAVGCGDV SVAIAAHAMA NYASATMW         118
//

If you have problems or comments...

PBIL Back to PBIL home page