(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE144

MICSR_1.PE144        Location/Qualifiers
FT   CDS             269255..272497
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636484"
FT                   /orf_name="MICPUN_99314"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="ACO61657.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="HOGENOM:HBG444787"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR011709"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI000199A823"
FT                   /db_xref="UniProtKB/TrEMBL:C1E121"
FT                   /transl_table=1
FT                   /translation="MPRSVGLDASSREALLDLIYRLSREDKDGGDEGGGDARAARGRGS
FT                   GSVEGADEDDADADPTRVRKDRVKEARRAEKERERKEKVLAKALKKDRRASAAEGANSR
FT                   DDGDAKGWASSPHPPGSEVNVSVTSAQGGGETKVMKIKRAADLKDFLSAAKSKLKLKKK
FT                   PLSARLVPSGREIRDTLRLEPMATVSVSADPPTERARERDDDDEDEKSAPGTGDGDIGD
FT                   GDTGDDPTERLREAVASRLRNAERDVDRSRLPPGGSDDATADESTRLLSLLSIDRSERT
FT                   ANATSRQALPAAAVRAEIIAACVDSDSRVSVVTGDTGSGKTTQAPQFVLEHFVAAGEGA
FT                   RCGIVVCQPRRVAAVSIARRVAEERGERVGDVVGYRVRGESRTSNRTRLTFCTTGVLLQ
FT                   RLRWDPTLEGITHVFVDEAHERTADADFLLILLRRLLRSGAAPGLRVTLMSATVDAGRF
FT                   IDYFAGEPGEPTPRSTHIPGRTFPVDEVFVEEYLPSRRRDRGGGEKNGRNGRNGDGHEI
FT                   DYDLLRAAVDKASRDVQRHGQKPLGAVLVFLPGVPEISRAEQAVSDVRDVRVFPLHGQL
FT                   APEDQRAAFAPAPPNKVKVVLATNAAETSVTIPDVTVVIDTGRVKRMTFESRTQLASLT
FT                   EGWCSLASAAQRRGRAGRVRAGVCVRLYERWAAGKSPMADHDEPEMRTAPLDTLVMRAL
FT                   AIAPGEHPAAVLGEALDPPDADAVRAAVERLRAIGAVVVDPRRGNGPGDSPGVSTTPLG
FT                   FHLSLLPVEPRVGKMLVMGCVMGCLSPVLTAAAAMSCRPMFTARGGDRADASAAKRRAS
FT                   RGSRSDHLACVNAFDEWMGSSNRRRTCADLNLSHAAMQDVARTRTQLRKRLEEAGFSPG
FT                   APAANAQTDNDDFVRCVLVAGLFPNVARVGVGPSGRTRVLNNRGVEVAVHPSGVNAAFH
FT                   RDDVDGDDGATRQGRGRRTFSGGGPETGLLVYQEEVTTSKTFIRDTTAVPDASVLLFGG
FT                   ELCVDHASASVSVSTGRSSAVGGGTASRFTFRAPPETGVLFKLLRKELTAVLASAVGDP
FT                   SGNHGTLEGSARGRRVREVLETLFPGSGVSAR"
     MPRSVGLDAS SREALLDLIY RLSREDKDGG DEGGGDARAA RGRGSGSVEG ADEDDADADP        60
     TRVRKDRVKE ARRAEKERER KEKVLAKALK KDRRASAAEG ANSRDDGDAK GWASSPHPPG       120
     SEVNVSVTSA QGGGETKVMK IKRAADLKDF LSAAKSKLKL KKKPLSARLV PSGREIRDTL       180
     RLEPMATVSV SADPPTERAR ERDDDDEDEK SAPGTGDGDI GDGDTGDDPT ERLREAVASR       240
     LRNAERDVDR SRLPPGGSDD ATADESTRLL SLLSIDRSER TANATSRQAL PAAAVRAEII       300
     AACVDSDSRV SVVTGDTGSG KTTQAPQFVL EHFVAAGEGA RCGIVVCQPR RVAAVSIARR       360
     VAEERGERVG DVVGYRVRGE SRTSNRTRLT FCTTGVLLQR LRWDPTLEGI THVFVDEAHE       420
     RTADADFLLI LLRRLLRSGA APGLRVTLMS ATVDAGRFID YFAGEPGEPT PRSTHIPGRT       480
     FPVDEVFVEE YLPSRRRDRG GGEKNGRNGR NGDGHEIDYD LLRAAVDKAS RDVQRHGQKP       540
     LGAVLVFLPG VPEISRAEQA VSDVRDVRVF PLHGQLAPED QRAAFAPAPP NKVKVVLATN       600
     AAETSVTIPD VTVVIDTGRV KRMTFESRTQ LASLTEGWCS LASAAQRRGR AGRVRAGVCV       660
     RLYERWAAGK SPMADHDEPE MRTAPLDTLV MRALAIAPGE HPAAVLGEAL DPPDADAVRA       720
     AVERLRAIGA VVVDPRRGNG PGDSPGVSTT PLGFHLSLLP VEPRVGKMLV MGCVMGCLSP       780
     VLTAAAAMSC RPMFTARGGD RADASAAKRR ASRGSRSDHL ACVNAFDEWM GSSNRRRTCA       840
     DLNLSHAAMQ DVARTRTQLR KRLEEAGFSP GAPAANAQTD NDDFVRCVLV AGLFPNVARV       900
     GVGPSGRTRV LNNRGVEVAV HPSGVNAAFH RDDVDGDDGA TRQGRGRRTF SGGGPETGLL       960
     VYQEEVTTSK TFIRDTTAVP DASVLLFGGE LCVDHASASV SVSTGRSSAV GGGTASRFTF      1020
     RAPPETGVLF KLLRKELTAV LASAVGDPSG NHGTLEGSAR GRRVREVLET LFPGSGVSAR      1080
//

If you have problems or comments...

PBIL Back to PBIL home page