(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE145

MICSR_1.PE145        Location/Qualifiers
FT   CDS             272672..273619
FT                   /codon_start=1
FT                   /gene_family="HOG000046604" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636485"
FT                   /orf_name="MICPUN_107876"
FT                   /product="Predicted protein"
FT                   /function="sulfotransferase activity"
FT                   /protein_id="ACO61658.1"
FT                   /db_xref="GO:0008146"
FT                   /db_xref="HOGENOM:HBG569189"
FT                   /db_xref="InterPro:IPR000863"
FT                   /db_xref="UniParc:UPI000199A824"
FT                   /db_xref="UniProtKB/TrEMBL:C1E122"
FT                   /transl_table=1
FT                   /translation="MAGWTKTKTYDSHHFDSGAWDVVKPRDDDIVIATAYKAGTTWMQQ
FT                   IVAQILFNGEPPAAVGELSPWVDLRVPPREVKEGMVEAIPGRRFLKTHLPTDALDYNPS
FT                   QKYIYVARDGRDAFMSLMNHYKFGNEMWYGALNESPGLVGAKLPAWEEACEGKEGDEAI
FT                   RAVFDKWLNTPWGEHPWEKDGWPFWSLFYNMKTWWDAKDLPNVLMVHFTDLKKDLAGQM
FT                   RRIADFIGVPVDEAKFDAQVHACTFEAMKGNAAAVAPLGGAMWKGGADTFINKGTNGRW
FT                   VGVLTDEQVAAYEKAAQERLGGECAKWLAAGGDI"
     MAGWTKTKTY DSHHFDSGAW DVVKPRDDDI VIATAYKAGT TWMQQIVAQI LFNGEPPAAV        60
     GELSPWVDLR VPPREVKEGM VEAIPGRRFL KTHLPTDALD YNPSQKYIYV ARDGRDAFMS       120
     LMNHYKFGNE MWYGALNESP GLVGAKLPAW EEACEGKEGD EAIRAVFDKW LNTPWGEHPW       180
     EKDGWPFWSL FYNMKTWWDA KDLPNVLMVH FTDLKKDLAG QMRRIADFIG VPVDEAKFDA       240
     QVHACTFEAM KGNAAAVAPL GGAMWKGGAD TFINKGTNGR WVGVLTDEQV AAYEKAAQER       300
     LGGECAKWLA AGGDI                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page