(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE146

MICSR_1.PE146        Location/Qualifiers
FT   CDS             275057..275593
FT                   /codon_start=1
FT                   /gene_family="HOG000233454" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636486"
FT                   /orf_name="MICPUN_93648"
FT                   /product="Predicted protein"
FT                   /function="small conjugating protein ligase activity "
FT                   /biological_process="post-translational protein
FT                   modification"
FT                   /biological_process="regulation of protein metabolic
FT                   process"
FT                   /protein_id="ACO61659.1"
FT                   /db_xref="GO:0019787"
FT                   /db_xref="GO:0043687"
FT                   /db_xref="GO:0051246"
FT                   /db_xref="HOGENOM:HBG756483"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="UniParc:UPI000199A825"
FT                   /db_xref="UniProtKB/TrEMBL:C1E123"
FT                   /transl_table=1
FT                   /translation="MSSLAKTRLQTERKGWRKDHPHGFVAKPRTARDGSVDLLNWDCKI
FT                   PGKAGTLWEKGLYPIRLEFTEDYPSKPPKVSFPAGFFHPNVYPSGKVCLSILNEDKGWK
FT                   PSITVKQILVGVQELLDNPNNADAAQEAAYKLFKKSGAEYAKRVRIEAAKYTEAPAGFV
FT                   AGGGATGAEDDVIVL"
     MSSLAKTRLQ TERKGWRKDH PHGFVAKPRT ARDGSVDLLN WDCKIPGKAG TLWEKGLYPI        60
     RLEFTEDYPS KPPKVSFPAG FFHPNVYPSG KVCLSILNED KGWKPSITVK QILVGVQELL       120
     DNPNNADAAQ EAAYKLFKKS GAEYAKRVRI EAAKYTEAPA GFVAGGGATG AEDDVIVL         178
//

If you have problems or comments...

PBIL Back to PBIL home page