(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE147

MICSR_1.PE147        Location/Qualifiers
FT   CDS             285066..287648
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636487"
FT                   /orf_name="MICPUN_56720"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61660.1"
FT                   /db_xref="InterPro:IPR009836"
FT                   /db_xref="UniParc:UPI000199A826"
FT                   /db_xref="UniProtKB/TrEMBL:C1E124"
FT                   /transl_table=1
FT                   /translation="MRLLDLLPNDSWLASKSSGSSSFALLRRPDDRPVPSVSVADMRAH
FT                   IAFLRAVHVHSTRDESSSLYVDGPPLRAAVGDYLAWLAEVSLGPSASPGPCPGEMLVTR
FT                   APTLPVAWCWHVHRLDPHAYVRDCASLVGAVPYPVPGVGFASDEDQVASPQRRIDPPDP
FT                   VSSSSHLADILVAAIGRHAPFLWQVSGAAYNDDAFLLSAASRYEEFVAMTVRARGASLA
FT                   PPLDIDLAWHTHMLRDSEYLRESARMRGVELGAMAHDNGEGMGAHGDTSRLEAPWAKTL
FT                   AAFRETVDVSETDGATAMKSAFEAAVPRGARHRGYAPAWWFARGESVVVVDDFLSPEEC
FT                   EAIVSQMPGPESAMNCPSGKKAQMYVDGDASVEARIRAAVSVGLGFEGEPEASKSSLVL
FT                   EDIVNRETGIGGTRSDQFDPHRSLTVERTTPTVKLPARVSVGTMHPHRDRLAIYTLEGE
FT                   TMFEDDTLTADGYTCVVYLKADGGTLVLEPDECPGSGDASWTPPGAKLTRREIDVRPGR
FT                   LVAWPNHAFKHCAGRRDVVEGEDAVAESRWLLGPFHFTPGRARLPQVGDCGSAGSYDTG
FT                   PSKPPPPPFELADIWPDHKVEWDFTPPEPLKMHRSGEAFQQKLRADLNRFAGTYKAVFE
FT                   KGEISLGDEPFKFFGLLSYQPLNLCLLPFMFIPFIGCTTVNVSPTYLESYTITLRPIGL
FT                   HTPQRNYEEDVMYGNQKSCYFGKCHGSYSEVRRRAGPMHVTGVGEAKDDKYKSVVRLTL
FT                   VEANENELRYRRKGKDATAVFDAEGSRAASLARTYPEDPEHKGIFQEWLEENKKRPFWS
FT                   DLSICEDSAPPDKRILDIDGEMVVRDGEIVLTESVDGREPFTITLKKQ"
     MRLLDLLPND SWLASKSSGS SSFALLRRPD DRPVPSVSVA DMRAHIAFLR AVHVHSTRDE        60
     SSSLYVDGPP LRAAVGDYLA WLAEVSLGPS ASPGPCPGEM LVTRAPTLPV AWCWHVHRLD       120
     PHAYVRDCAS LVGAVPYPVP GVGFASDEDQ VASPQRRIDP PDPVSSSSHL ADILVAAIGR       180
     HAPFLWQVSG AAYNDDAFLL SAASRYEEFV AMTVRARGAS LAPPLDIDLA WHTHMLRDSE       240
     YLRESARMRG VELGAMAHDN GEGMGAHGDT SRLEAPWAKT LAAFRETVDV SETDGATAMK       300
     SAFEAAVPRG ARHRGYAPAW WFARGESVVV VDDFLSPEEC EAIVSQMPGP ESAMNCPSGK       360
     KAQMYVDGDA SVEARIRAAV SVGLGFEGEP EASKSSLVLE DIVNRETGIG GTRSDQFDPH       420
     RSLTVERTTP TVKLPARVSV GTMHPHRDRL AIYTLEGETM FEDDTLTADG YTCVVYLKAD       480
     GGTLVLEPDE CPGSGDASWT PPGAKLTRRE IDVRPGRLVA WPNHAFKHCA GRRDVVEGED       540
     AVAESRWLLG PFHFTPGRAR LPQVGDCGSA GSYDTGPSKP PPPPFELADI WPDHKVEWDF       600
     TPPEPLKMHR SGEAFQQKLR ADLNRFAGTY KAVFEKGEIS LGDEPFKFFG LLSYQPLNLC       660
     LLPFMFIPFI GCTTVNVSPT YLESYTITLR PIGLHTPQRN YEEDVMYGNQ KSCYFGKCHG       720
     SYSEVRRRAG PMHVTGVGEA KDDKYKSVVR LTLVEANENE LRYRRKGKDA TAVFDAEGSR       780
     AASLARTYPE DPEHKGIFQE WLEENKKRPF WSDLSICEDS APPDKRILDI DGEMVVRDGE       840
     IVLTESVDGR EPFTITLKKQ                                                   860
//

If you have problems or comments...

PBIL Back to PBIL home page