(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE15

MICSR_1.PE15         Location/Qualifiers
FT   CDS             complement(28735..31185)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636020"
FT                   /orf_name="MICPUN_56586"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62036.1"
FT                   /db_xref="UniParc:UPI000199AAB1"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0P2"
FT                   /transl_table=1
FT                   /translation="MKGQQNGAGDGSVGNQPPAGYLQRLWAWLRRPQARGKTNHHIRRS
FT                   RRLSHFATLKTMPELADVPSKCISSPAYRSGSAWEMEYAGKDMMTLLGDAMKSSCSPSD
FT                   LRNAALVCKEWRSMLGYAPAVASILRGGDAFAIAKMLAAKDIESVVQHHISDFVRVLAR
FT                   TAETEEDDTFLATSVADLGNIWMFAFKLSWNSHAEQMIEAWLKVFVTRVREMHLMCSDG
FT                   DPINAAITCIGPVDRNDADVDARLVLHMDLRQTVRRIGEALVPRLGDIIDRASRRLNNI
FT                   MQSLNNLWLHRFHDFIGSPSHVDPSESFATREAVEVDIDNLVAYSLVIRAVFLEFPREA
FT                   SVHLRSLLPLLSIEFDEVQGYLLFEFGVQNAFIGIREKYLSPGGRYATYVKTMQENFSV
FT                   VINITDALLAMQKVVKNGWEPDGLHDALLQALLGSSGDKKLELVRAFPTVAARNLSWLY
FT                   EAITLPDDYVHDEEAGRDADVWDHIEAGVNLVCCLLDTEVQFDGNLIMDRLVRLVPFDR
FT                   GPELLWAINELVRRELTDLRPDAHVIADVLDRPNYMKTRDQAITAFGLLGDEAEPHLDR
FT                   FMEQMKEVLVQETGDRFVQTLYEHRYRLKQNHLRDIILCLNESDWIPEIVTALETVRVL
FT                   CKTEEDATQIMYTMFYEMLDLTSEIDDDGQSYFPCNGGNYLFEAIQYVALRVDEPTRRE
FT                   ILQYLRANSKGPSSQNPYRWLSMLHIRAMIEKDVSPALALDHMLEMYDNNDGDRRRRDD
FT                   IVDYKVEQLEIFNEGRRKLRSEYCDRLAELRLQAEDAFDFLSSSDEEDADDDRDSTGSE
FT                   DIEF"
     MKGQQNGAGD GSVGNQPPAG YLQRLWAWLR RPQARGKTNH HIRRSRRLSH FATLKTMPEL        60
     ADVPSKCISS PAYRSGSAWE MEYAGKDMMT LLGDAMKSSC SPSDLRNAAL VCKEWRSMLG       120
     YAPAVASILR GGDAFAIAKM LAAKDIESVV QHHISDFVRV LARTAETEED DTFLATSVAD       180
     LGNIWMFAFK LSWNSHAEQM IEAWLKVFVT RVREMHLMCS DGDPINAAIT CIGPVDRNDA       240
     DVDARLVLHM DLRQTVRRIG EALVPRLGDI IDRASRRLNN IMQSLNNLWL HRFHDFIGSP       300
     SHVDPSESFA TREAVEVDID NLVAYSLVIR AVFLEFPREA SVHLRSLLPL LSIEFDEVQG       360
     YLLFEFGVQN AFIGIREKYL SPGGRYATYV KTMQENFSVV INITDALLAM QKVVKNGWEP       420
     DGLHDALLQA LLGSSGDKKL ELVRAFPTVA ARNLSWLYEA ITLPDDYVHD EEAGRDADVW       480
     DHIEAGVNLV CCLLDTEVQF DGNLIMDRLV RLVPFDRGPE LLWAINELVR RELTDLRPDA       540
     HVIADVLDRP NYMKTRDQAI TAFGLLGDEA EPHLDRFMEQ MKEVLVQETG DRFVQTLYEH       600
     RYRLKQNHLR DIILCLNESD WIPEIVTALE TVRVLCKTEE DATQIMYTMF YEMLDLTSEI       660
     DDDGQSYFPC NGGNYLFEAI QYVALRVDEP TRREILQYLR ANSKGPSSQN PYRWLSMLHI       720
     RAMIEKDVSP ALALDHMLEM YDNNDGDRRR RDDIVDYKVE QLEIFNEGRR KLRSEYCDRL       780
     AELRLQAEDA FDFLSSSDEE DADDDRDSTG SEDIEF                                 816
//

If you have problems or comments...

PBIL Back to PBIL home page