(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE151

MICSR_1.PE151        Location/Qualifiers
FT   CDS             297318..299243
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636491"
FT                   /orf_name="MICPUN_56724"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61661.1"
FT                   /db_xref="UniParc:UPI000199A89A"
FT                   /db_xref="UniProtKB/TrEMBL:C1E128"
FT                   /transl_table=1
FT                   /translation="METPSREVSDAGSAARRNPRSPGVSLGRGLDSFLDDLTPEATRQA
FT                   TTEDRAALLQLTKFRERLAAMGDGAGDGDEHDPPATPSDSPRTMDTTSRASSPPSPDEN
FT                   APPGTGIPGMTPRKVHPSFTLPPHEQQRRDAAAAAAVRTRGTSPSLITSPSGRIEVGAT
FT                   ATTTARSSPLGREPTTPTDLDDAGGSQRRRRARVLEDGTDVFGRDDDDVFGRDNDDGDG
FT                   LTETRGSAAADTTARPPADDPRSLATRSNDDPRIVGRLLGSVEAALAEAVTPRAALGAL
FT                   RADVDECRAAIDALRESHVALEREDGALTEAQGQMREELDDAWRTRLPRLERLMFRLAD
FT                   RLDRVVDEAVAASEAVNVRRLEEELGRLRVEIAETIASIGDGTGEAVGEATLEAIAHVD
FT                   SSVNALRAETAAAVESVRVETLARLERMEAAQLAEEARRKSAVESAVESTRGSRHWSSF
FT                   AAGLEPCVDVITALAARVLGPGRRSGKDERESYPAVTATGSALDDEASGVINRGLRRQI
FT                   HRCKTIGGVEGVAWDDDAGADLLGASLVVLAAEAAHAIAPRGPCRVATRVVRAAVWTST
FT                   AALASGAVKSWCHRVANEAMAERRRRLEGGAKEGADVDDDDEEEERFETPPARSSADPE
FT                   LFVDTH"
     METPSREVSD AGSAARRNPR SPGVSLGRGL DSFLDDLTPE ATRQATTEDR AALLQLTKFR        60
     ERLAAMGDGA GDGDEHDPPA TPSDSPRTMD TTSRASSPPS PDENAPPGTG IPGMTPRKVH       120
     PSFTLPPHEQ QRRDAAAAAA VRTRGTSPSL ITSPSGRIEV GATATTTARS SPLGREPTTP       180
     TDLDDAGGSQ RRRRARVLED GTDVFGRDDD DVFGRDNDDG DGLTETRGSA AADTTARPPA       240
     DDPRSLATRS NDDPRIVGRL LGSVEAALAE AVTPRAALGA LRADVDECRA AIDALRESHV       300
     ALEREDGALT EAQGQMREEL DDAWRTRLPR LERLMFRLAD RLDRVVDEAV AASEAVNVRR       360
     LEEELGRLRV EIAETIASIG DGTGEAVGEA TLEAIAHVDS SVNALRAETA AAVESVRVET       420
     LARLERMEAA QLAEEARRKS AVESAVESTR GSRHWSSFAA GLEPCVDVIT ALAARVLGPG       480
     RRSGKDERES YPAVTATGSA LDDEASGVIN RGLRRQIHRC KTIGGVEGVA WDDDAGADLL       540
     GASLVVLAAE AAHAIAPRGP CRVATRVVRA AVWTSTAALA SGAVKSWCHR VANEAMAERR       600
     RRLEGGAKEG ADVDDDDEEE ERFETPPARS SADPELFVDT H                           641
//

If you have problems or comments...

PBIL Back to PBIL home page