(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE152

MICSR_1.PE152        Location/Qualifiers
FT   CDS             299356..300531
FT                   /codon_start=1
FT                   /gene_family="HOG000250278" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636492"
FT                   /orf_name="MICPUN_56725"
FT                   /product="Aryl-alcohol dehydrogenase related protein "
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO61662.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG605727"
FT                   /db_xref="InterPro:IPR001395"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="UniParc:UPI000199A89B"
FT                   /db_xref="UniProtKB/TrEMBL:C1E129"
FT                   /transl_table=1
FT                   /translation="MKPATVLSSSVAPVGVSRSRAAPRRAAVAARASTDAAATTPAAGV
FT                   GNTFRTATDRVTLGTSDLSVAATGAGAWAWGDRSGYWGSDWEGDRAKNLDAYMTLLAGG
FT                   VDFIDTAEVYGFGKSEELIREFMRDTAADATLAPPLLATKFAPIPFRFRAEDVPNALRA
FT                   SMARMGVRKVALYMQHWPAFGLPGVTEACNDAFLEGLCLCYERGLCRAVGVSNFNAERV
FT                   KRAAKKFKERGVPFASNQIQYSLAYRAPETDTGVIDACVECGVTPVAYSPMAQGLLTGK
FT                   YSAASPLGEGVKATGPRARILSEEKLASADALVDLMREIGRNHGGVTPAQIAVNYCMTK
FT                   GTVPIPGAKDARQAEAVVGCLGWRLDEAEVAELEAAAALVPSTPGAPFERW"
     MKPATVLSSS VAPVGVSRSR AAPRRAAVAA RASTDAAATT PAAGVGNTFR TATDRVTLGT        60
     SDLSVAATGA GAWAWGDRSG YWGSDWEGDR AKNLDAYMTL LAGGVDFIDT AEVYGFGKSE       120
     ELIREFMRDT AADATLAPPL LATKFAPIPF RFRAEDVPNA LRASMARMGV RKVALYMQHW       180
     PAFGLPGVTE ACNDAFLEGL CLCYERGLCR AVGVSNFNAE RVKRAAKKFK ERGVPFASNQ       240
     IQYSLAYRAP ETDTGVIDAC VECGVTPVAY SPMAQGLLTG KYSAASPLGE GVKATGPRAR       300
     ILSEEKLASA DALVDLMREI GRNHGGVTPA QIAVNYCMTK GTVPIPGAKD ARQAEAVVGC       360
     LGWRLDEAEV AELEAAAALV PSTPGAPFER W                                      391
//

If you have problems or comments...

PBIL Back to PBIL home page