(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE153

MICSR_1.PE153        Location/Qualifiers
FT   CDS             join(300990..301088,301244..301690)
FT                   /codon_start=1
FT                   /gene_family="HOG000163282" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636493"
FT                   /orf_name="MICPUN_105248"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO61663.1"
FT                   /db_xref="HOGENOM:HBG609692"
FT                   /db_xref="InterPro:IPR009445"
FT                   /db_xref="UniParc:UPI000199A89C"
FT                   /db_xref="UniProtKB/TrEMBL:C1E130"
FT                   /transl_table=1
FT                   /translation="MDAKWRLDFADASTSGNNAPVNPPGYASLRELGDVDAPAKGKADA
FT                   PKGGVVAPGGALTSAARQQKAYQFAMSQVQAIGMTGFMMYMAGSGVQIFSMMVVGNGLF
FT                   QPIKAIASSGKIFEPYADASTDVTGPRALFCAIQLAGLAMALYKLNSMGLLPTHASDWV
FT                   SGMKPPTPVEHAYGGTTL"
     MDAKWRLDFA DASTSGNNAP VNPPGYASLR ELGDVDAPAK GKADAPKGGV VAPGGALTSA        60
     ARQQKAYQFA MSQVQAIGMT GFMMYMAGSG VQIFSMMVVG NGLFQPIKAI ASSGKIFEPY       120
     ADASTDVTGP RALFCAIQLA GLAMALYKLN SMGLLPTHAS DWVSGMKPPT PVEHAYGGTT       180
     L                                                                       181
//

If you have problems or comments...

PBIL Back to PBIL home page