(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE154

MICSR_1.PE154        Location/Qualifiers
FT   CDS             301973..302530
FT                   /codon_start=1
FT                   /gene_family="HOG000100022" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636494"
FT                   /orf_name="MICPUN_99323"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61664.1"
FT                   /db_xref="HOGENOM:HBG560012"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000199A89D"
FT                   /db_xref="UniProtKB/TrEMBL:C1E131"
FT                   /transl_table=1
FT                   /translation="MRYIPHKRGKPSRWVREAAGNDDVEGIDAALDAASNKDEALNKGD
FT                   IMGRTALHWAAGRGRVDAVRHLLALGARVKISGMHHTPLHDLAESGAAAAPTLVQELVE
FT                   AAPWQLTYKDNTGAMPVDRAKSAGQRQMVRALESAAMMVTGAERAMMSRHTHSFLPSCL
FT                   SVATISLDSPGSSVTRPLLEGA"
     MRYIPHKRGK PSRWVREAAG NDDVEGIDAA LDAASNKDEA LNKGDIMGRT ALHWAAGRGR        60
     VDAVRHLLAL GARVKISGMH HTPLHDLAES GAAAAPTLVQ ELVEAAPWQL TYKDNTGAMP       120
     VDRAKSAGQR QMVRALESAA MMVTGAERAM MSRHTHSFLP SCLSVATISL DSPGSSVTRP       180
     LLEGA                                                                   185
//

If you have problems or comments...

PBIL Back to PBIL home page