(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE155

MICSR_1.PE155        Location/Qualifiers
FT   CDS             302802..303365
FT                   /codon_start=1
FT                   /gene_family="HOG000100022" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636495"
FT                   /orf_name="MICPUN_56728"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61665.1"
FT                   /db_xref="HOGENOM:HBG560012"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000199A89E"
FT                   /db_xref="UniProtKB/TrEMBL:C1E132"
FT                   /transl_table=1
FT                   /translation="MSYARPKRGKPERWVREAAGNDDVEGIDAALDAAKDRERLLNKGD
FT                   FVGRTALHWAAGRGRADAVRHLLALGARVKLSGNQASPLHDLAASGSPNAPALVQDLLA
FT                   AAPWQLTHRDNMGHYPVDKARDVGDKSMALALDALMMTVVGKRGPTAKPRTPSSWMPSC
FT                   MSAGKARGIVGSDERPLLEGAARA"
     MSYARPKRGK PERWVREAAG NDDVEGIDAA LDAAKDRERL LNKGDFVGRT ALHWAAGRGR        60
     ADAVRHLLAL GARVKLSGNQ ASPLHDLAAS GSPNAPALVQ DLLAAAPWQL THRDNMGHYP       120
     VDKARDVGDK SMALALDALM MTVVGKRGPT AKPRTPSSWM PSCMSAGKAR GIVGSDERPL       180
     LEGAARA                                                                 187
//

If you have problems or comments...

PBIL Back to PBIL home page