(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE158

MICSR_1.PE158        Location/Qualifiers
FT   CDS             307809..308090
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636498"
FT                   /orf_name="MICPUN_56731"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61667.1"
FT                   /db_xref="UniParc:UPI000199A8A1"
FT                   /db_xref="UniProtKB/TrEMBL:C1E135"
FT                   /transl_table=1
FT                   /translation="MRKETAFLLVICYVAFHLSQLSLEDLVAHLESGKQIVAGVLADPI
FT                   GKGQEYYDRLVQTGAAKFLAFAAASKLISWHFKRSATSRKIAADKKAK"
     MRKETAFLLV ICYVAFHLSQ LSLEDLVAHL ESGKQIVAGV LADPIGKGQE YYDRLVQTGA        60
     AKFLAFAAAS KLISWHFKRS ATSRKIAADK KAK                                     93
//

If you have problems or comments...

PBIL Back to PBIL home page