(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE16

MICSR_1.PE16         Location/Qualifiers
FT   CDS             31431..32483
FT                   /codon_start=1
FT                   /gene_family="HOG000100015" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636021"
FT                   /orf_name="MICPUN_107848"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61592.1"
FT                   /db_xref="InterPro:IPR011498"
FT                   /db_xref="InterPro:IPR015915"
FT                   /db_xref="UniParc:UPI000199AAB2"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0P3"
FT                   /transl_table=1
FT                   /translation="MWIRPAILGAQPSGRGGCASATVGDMCLFIGGTDRSPRAFDEVWI
FT                   LKMAPESTDGVSSSDWRWIRKSTTVRGGGTLPARTGATATAVGRKVYVFGGQEPSRGTC
FT                   FNDVVVLDCDSWEWSRLEISGPSPPPRNSHVACVVNGGRLLVVYGGSSPEVGPMSDVYL
FT                   LDLEEGAERWIRPKVTGQAPEPREMHAACVLPNTPGDGDWNGDREIIVVGGRGGASVLS
FT                   DAVVLDAQRLEWVRRGDVGVAVCAHTAVPWRLGRSGAALLFGGFGGAALRGNDTVTVDG
FT                   TTLKTIVKGVSSEDVAFAPEPRFAHSSCLVPGGGMLVFAGVTPEADLGDVAVWVPDERA
FT                   SGVVPACDLD"
     MWIRPAILGA QPSGRGGCAS ATVGDMCLFI GGTDRSPRAF DEVWILKMAP ESTDGVSSSD        60
     WRWIRKSTTV RGGGTLPART GATATAVGRK VYVFGGQEPS RGTCFNDVVV LDCDSWEWSR       120
     LEISGPSPPP RNSHVACVVN GGRLLVVYGG SSPEVGPMSD VYLLDLEEGA ERWIRPKVTG       180
     QAPEPREMHA ACVLPNTPGD GDWNGDREII VVGGRGGASV LSDAVVLDAQ RLEWVRRGDV       240
     GVAVCAHTAV PWRLGRSGAA LLFGGFGGAA LRGNDTVTVD GTTLKTIVKG VSSEDVAFAP       300
     EPRFAHSSCL VPGGGMLVFA GVTPEADLGD VAVWVPDERA SGVVPACDLD                  350
//

If you have problems or comments...

PBIL Back to PBIL home page