(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE162

MICSR_1.PE162        Location/Qualifiers
FT   CDS             join(complement(313412..313733),complement(312717..313291))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636502"
FT                   /orf_name="MICPUN_56735"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO62105.1"
FT                   /db_xref="UniParc:UPI000199A8A5"
FT                   /db_xref="UniProtKB/TrEMBL:C1E139"
FT                   /transl_table=1
FT                   /translation="MGEVTNRATTAAIAVGAAAALGLSYLAHGWYRSRRSPRVLVLVSG
FT                   TLQDGFPLRRNLDAPGAPAEFVGWALVRGVKMYLDPKPRGCREWVDPESGERQRVNPAL
FT                   VCTGDPKDANVYACYAVSEGACLRALLGEPRMLGMTPDTALVDLRAEETSRALASFLAG
FT                   QARRWWENSTPAFGDVAVTERGTLDEGRVAMLTVVAHRVPHGAVPVEPAYVKDDGTRVT
FT                   SFAPCLKRFGGGFELGTRAHELGLEEAIRKWQRRMDPGDGTRGDSLYGAAPETFRMNYA
FT                   VTAGEVARTFSSKRVAA"
     MGEVTNRATT AAIAVGAAAA LGLSYLAHGW YRSRRSPRVL VLVSGTLQDG FPLRRNLDAP        60
     GAPAEFVGWA LVRGVKMYLD PKPRGCREWV DPESGERQRV NPALVCTGDP KDANVYACYA       120
     VSEGACLRAL LGEPRMLGMT PDTALVDLRA EETSRALASF LAGQARRWWE NSTPAFGDVA       180
     VTERGTLDEG RVAMLTVVAH RVPHGAVPVE PAYVKDDGTR VTSFAPCLKR FGGGFELGTR       240
     AHELGLEEAI RKWQRRMDPG DGTRGDSLYG AAPETFRMNY AVTAGEVART FSSKRVAA         298
//

If you have problems or comments...

PBIL Back to PBIL home page