(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE166

MICSR_1.PE166        Location/Qualifiers
FT   CDS             318500..320269
FT                   /codon_start=1
FT                   /gene_family="HOG000250646" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636506"
FT                   /orf_name="MICPUN_56739"
FT                   /product="Metal dependent hydrolase "
FT                   /function="hydrolase activity, acting on carbon-nitrogen
FT                   (but not peptide) bonds"
FT                   /protein_id="ACO61672.1"
FT                   /db_xref="GO:0016810"
FT                   /db_xref="HOGENOM:HBG668170"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="UniParc:UPI000199A90B"
FT                   /db_xref="UniProtKB/TrEMBL:C1E143"
FT                   /transl_table=1
FT                   /translation="MDLTLDNSVGKFSPSPAPPAGPPTLLRGALVPNDASEPGTYTRRD
FT                   VLIADGVLKRVAPGGTLSLDVDCPPGTIEEDCSERMLVPGFVNGHTHSVEHWARGLIKP
FT                   LPLEMWVLQLIRHEPRGEEGWAGPESWIKTPAAAIAVSAMHCGVEALLSGTTAIMDHLL
FT                   CRDIKDVEAAVFAYRALGIRAYIAPMLGDDLEPYVNYVPLARDAQGRNGAICGPAGPAP
FT                   GCPDCGGLGAHGSFRTEVGERDPAKTEANLALWREAAQKFHDPKNGINIVVGPVTAYSA
FT                   STELLRGAAEIRKEFGLCGHIHLLETRAQALMARQFLPSGSAVKHLRDTGFLQVPGTTC
FT                   GHCVWLDDEEIAIMAECDATAVHNPFSNLRLGSGVAPLHKYARLGMNVCLGADGACSSD
FT                   GQDMLEVAKLANILPCVATPEYRDWPTAHHTALVLGAANGYKGILLEGKPGQVGKGGVL
FT                   EEGALADLSSWDLTALSMLPRTDPLSLLVQGSRTQAPGAGSALDCAWVNGVRVVQGGSP
FT                   VNVDVKALREVLRAAQGTYRDPAITDPSTHEKTARAETEYRAAMDLDPAGATGLRPAYE
FT                   WPEHCVLYPASQN"
     MDLTLDNSVG KFSPSPAPPA GPPTLLRGAL VPNDASEPGT YTRRDVLIAD GVLKRVAPGG        60
     TLSLDVDCPP GTIEEDCSER MLVPGFVNGH THSVEHWARG LIKPLPLEMW VLQLIRHEPR       120
     GEEGWAGPES WIKTPAAAIA VSAMHCGVEA LLSGTTAIMD HLLCRDIKDV EAAVFAYRAL       180
     GIRAYIAPML GDDLEPYVNY VPLARDAQGR NGAICGPAGP APGCPDCGGL GAHGSFRTEV       240
     GERDPAKTEA NLALWREAAQ KFHDPKNGIN IVVGPVTAYS ASTELLRGAA EIRKEFGLCG       300
     HIHLLETRAQ ALMARQFLPS GSAVKHLRDT GFLQVPGTTC GHCVWLDDEE IAIMAECDAT       360
     AVHNPFSNLR LGSGVAPLHK YARLGMNVCL GADGACSSDG QDMLEVAKLA NILPCVATPE       420
     YRDWPTAHHT ALVLGAANGY KGILLEGKPG QVGKGGVLEE GALADLSSWD LTALSMLPRT       480
     DPLSLLVQGS RTQAPGAGSA LDCAWVNGVR VVQGGSPVNV DVKALREVLR AAQGTYRDPA       540
     ITDPSTHEKT ARAETEYRAA MDLDPAGATG LRPAYEWPEH CVLYPASQN                   589
//

If you have problems or comments...

PBIL Back to PBIL home page