(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE167

MICSR_1.PE167        Location/Qualifiers
FT   CDS             join(320782..321776,322138..322363)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636507"
FT                   /orf_name="MICPUN_56740"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61673.1"
FT                   /db_xref="UniParc:UPI000199A90C"
FT                   /db_xref="UniProtKB/TrEMBL:C1E144"
FT                   /transl_table=1
FT                   /translation="MWTPGHGPELRRARPTCGVDDVDEARFNPLCRRARGVEDDSDPSE
FT                   SDTGFDDDDDDSHSSECDLVENVRQARLNALRRRRDDREEIRRQNETLDRIHRARHAER
FT                   EMAKELSSMRFEAERRHTLAWGDDAEVRDRERAAERAAEAIGDAMDEEELIESTQRGAG
FT                   GDGGVARAAEEAHAWATHDEAWAAFEASVRDGARVRTRDVPWPPGHDRGGDGGGGGTLL
FT                   ASLARCELVERGGGGGAGSCRGGSEDKRLAAFRRAFKRASLRWHPDKFEGKFGGALCDD
FT                   VCGDDDDGMVRTGGTGGTGGEGRGETHAQHIRRRVRCIAQEINDAWSAIVAFAQRRNYL
FT                   ILSLWANVPIDFKARWIAIAVWIEEIGFQFFGLDSREPFAGYFPFTADSLYDGDAGIDP
FT                   HCLSLIA"
     MWTPGHGPEL RRARPTCGVD DVDEARFNPL CRRARGVEDD SDPSESDTGF DDDDDDSHSS        60
     ECDLVENVRQ ARLNALRRRR DDREEIRRQN ETLDRIHRAR HAEREMAKEL SSMRFEAERR       120
     HTLAWGDDAE VRDRERAAER AAEAIGDAMD EEELIESTQR GAGGDGGVAR AAEEAHAWAT       180
     HDEAWAAFEA SVRDGARVRT RDVPWPPGHD RGGDGGGGGT LLASLARCEL VERGGGGGAG       240
     SCRGGSEDKR LAAFRRAFKR ASLRWHPDKF EGKFGGALCD DVCGDDDDGM VRTGGTGGTG       300
     GEGRGETHAQ HIRRRVRCIA QEINDAWSAI VAFAQRRNYL ILSLWANVPI DFKARWIAIA       360
     VWIEEIGFQF FGLDSREPFA GYFPFTADSL YDGDAGIDPH CLSLIA                      406
//

If you have problems or comments...

PBIL Back to PBIL home page