(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE169

MICSR_1.PE169        Location/Qualifiers
FT   CDS             325610..329869
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636509"
FT                   /orf_name="MICPUN_56742"
FT                   /product="C2 domain-containing protein "
FT                   /protein_id="ACO61675.1"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="UniParc:UPI000199A90E"
FT                   /db_xref="UniProtKB/TrEMBL:C1E146"
FT                   /transl_table=1
FT                   /translation="MSGQVVTGTPVFSMSPSNPRSAQVQPGMAPATPPPFNGSSSMSAP
FT                   GYGAGAEGPGASSSPAHTALDVDDQGNRGGDFVTRTWQPARAPDAVALAEVTSQMTSAA
FT                   NVAEVFKATGLGQQDIQSSASRTTEDDGLIVRQRPRARADNIAVRKARAAREARPGDWF
FT                   DPNDGGILCQADPVPPGVERARPARWFDPEAPYLQTVPATDSRIDLEIVDAAGSDRTYR
FT                   FDISVGRLEFSCHPLMSKEDFLAAQLEESFRSYKRREASDLVTLYTAKSAAAAARARAL
FT                   RQEMAAGAALWLAGVSPSDRLIALEEEAEEAQRLAIDEGDRMKASVQHMSELHDAIERE
FT                   RIAYGCRSTSIRFAVRQKGNGESEPVLLAGAARDEGAHVPKPEQQRRAKATSTRFCVAL
FT                   EVNGQQVPGTSRPVTLRSSGGFSTEVAHAFSLSVQRWPDSVRLALYEKGTIVDTFLAVV
FT                   PIAVPGSNPGEPLQDPAPRQYQFSAESPHAPTWRGAQPGASQVQYTSGSLFVTCAWTPN
FT                   AAEAINMGAYGRQHTADVERSVPVAPPPPPSTAAKRAAAAAKVGYADAAGGFGRAVPRP
FT                   APDAVPGGSPSKTSAAALRASLDPLNPEDATLLETLATREALRNAGGGGFRLNLNDETM
FT                   LGVNAKATKRQQLLKLRAEGGVEALPEGGVPLSEGDIPDHLLEQNAEVQSQSKLLSAQL
FT                   PGLAEADKRATRIAEFLAKVKLNVAKGRRDQKMGARASKGVMHTDDVVKDSPLPDITFD
FT                   LTGVFEFFQPRRKLRPARRRAAPPESHPDYCELVVGIQKAFNLPTRAGMQGGAMGGVGG
FT                   GRRSMQRGGGGGGGGYGGGYGDGYGGGAALVASGELNSFVEVSFQGQTLRTRLANGSAP
FT                   SWQESLQLPFRPPGGDFSPAALQGCEDVVTISLFDEATEPAERTYGAGAVAGGTSTTQH
FT                   FLGSIDIPVAALYRGDGGKIEGVLPLDAPPVLLGYSGAGGGGGSGGGRASLPGGGGLAQ
FT                   QPKPSMSVYIQFAPALAKPEPTLSDPGVGEDESVLRHAKVWEKECRAASRHTKQRPYRA
FT                   VATDGMGRSVHLCRYIASAQLPPGFQGAVADEPTLRQLMRFCHLVPHVTDMSAFNLPPG
FT                   VDIWTTSQEFLDMCAGDSEEHALLLCGFLVALGVEAYVVLGVSATDSDAAMVFTPGGQG
FT                   KRPGNPPTYAPMLEDSLIWDPMAGTIFSVYDSACSACLGEIGVVFNSDNVWANVQAHGR
FT                   PHEMNWNLNDTHGWRPFFSAGSFPHRAMPTVQTAITYESYPPAFYERLGAAVEREAMDA
FT                   IVKKRARQHTPFNRRASRALKDLLRDLEGQILISPDDQGGGLNLGGGMRVGSLTELHMS
FT                   QLAGICEGYTVTGCPMNLPFTDAATVRDVIDRLKIADTTRSDVEFAVATHVEPYGCTFV
FT                   CSVWVYVVRLTKISSYQ"
     MSGQVVTGTP VFSMSPSNPR SAQVQPGMAP ATPPPFNGSS SMSAPGYGAG AEGPGASSSP        60
     AHTALDVDDQ GNRGGDFVTR TWQPARAPDA VALAEVTSQM TSAANVAEVF KATGLGQQDI       120
     QSSASRTTED DGLIVRQRPR ARADNIAVRK ARAAREARPG DWFDPNDGGI LCQADPVPPG       180
     VERARPARWF DPEAPYLQTV PATDSRIDLE IVDAAGSDRT YRFDISVGRL EFSCHPLMSK       240
     EDFLAAQLEE SFRSYKRREA SDLVTLYTAK SAAAAARARA LRQEMAAGAA LWLAGVSPSD       300
     RLIALEEEAE EAQRLAIDEG DRMKASVQHM SELHDAIERE RIAYGCRSTS IRFAVRQKGN       360
     GESEPVLLAG AARDEGAHVP KPEQQRRAKA TSTRFCVALE VNGQQVPGTS RPVTLRSSGG       420
     FSTEVAHAFS LSVQRWPDSV RLALYEKGTI VDTFLAVVPI AVPGSNPGEP LQDPAPRQYQ       480
     FSAESPHAPT WRGAQPGASQ VQYTSGSLFV TCAWTPNAAE AINMGAYGRQ HTADVERSVP       540
     VAPPPPPSTA AKRAAAAAKV GYADAAGGFG RAVPRPAPDA VPGGSPSKTS AAALRASLDP       600
     LNPEDATLLE TLATREALRN AGGGGFRLNL NDETMLGVNA KATKRQQLLK LRAEGGVEAL       660
     PEGGVPLSEG DIPDHLLEQN AEVQSQSKLL SAQLPGLAEA DKRATRIAEF LAKVKLNVAK       720
     GRRDQKMGAR ASKGVMHTDD VVKDSPLPDI TFDLTGVFEF FQPRRKLRPA RRRAAPPESH       780
     PDYCELVVGI QKAFNLPTRA GMQGGAMGGV GGGRRSMQRG GGGGGGGYGG GYGDGYGGGA       840
     ALVASGELNS FVEVSFQGQT LRTRLANGSA PSWQESLQLP FRPPGGDFSP AALQGCEDVV       900
     TISLFDEATE PAERTYGAGA VAGGTSTTQH FLGSIDIPVA ALYRGDGGKI EGVLPLDAPP       960
     VLLGYSGAGG GGGSGGGRAS LPGGGGLAQQ PKPSMSVYIQ FAPALAKPEP TLSDPGVGED      1020
     ESVLRHAKVW EKECRAASRH TKQRPYRAVA TDGMGRSVHL CRYIASAQLP PGFQGAVADE      1080
     PTLRQLMRFC HLVPHVTDMS AFNLPPGVDI WTTSQEFLDM CAGDSEEHAL LLCGFLVALG      1140
     VEAYVVLGVS ATDSDAAMVF TPGGQGKRPG NPPTYAPMLE DSLIWDPMAG TIFSVYDSAC      1200
     SACLGEIGVV FNSDNVWANV QAHGRPHEMN WNLNDTHGWR PFFSAGSFPH RAMPTVQTAI      1260
     TYESYPPAFY ERLGAAVERE AMDAIVKKRA RQHTPFNRRA SRALKDLLRD LEGQILISPD      1320
     DQGGGLNLGG GMRVGSLTEL HMSQLAGICE GYTVTGCPMN LPFTDAATVR DVIDRLKIAD      1380
     TTRSDVEFAV ATHVEPYGCT FVCSVWVYVV RLTKISSYQ                             1419
//

If you have problems or comments...

PBIL Back to PBIL home page