(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE17

MICSR_1.PE17         Location/Qualifiers
FT   CDS             complement(32563..33558)
FT                   /codon_start=1
FT                   /gene_family="HOG000207661" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636022"
FT                   /orf_name="MICPUN_107849"
FT                   /product="Predicted protein"
FT                   /function="nucleotide binding"
FT                   /protein_id="ACO62037.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="HOGENOM:HBG326130"
FT                   /db_xref="InterPro:IPR004130"
FT                   /db_xref="UniParc:UPI000199AAB3"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0P4"
FT                   /transl_table=1
FT                   /translation="MGFGQLVIGPPGSGKTTYCNGIQHFFQLTGRPCAVINLDPANHDP
FT                   PYECAVSVEELITLEEAQREFNLGPNGAMVYCIEYVSKNLDWLKERVTPLVAEGKYVLF
FT                   DLPGQVELFNMHDALREVVAAITGPEWNLRLCTVHLIDSHLCADPAKYIAALMLSLSSM
FT                   LHLETPHVNVLSKVDLMDKYGELDFNLEYYADVMNLEYLADRILDGNQDAIGTAPSPGQ
FT                   TMMRKKYGKLTKGLCELVEDFGLVNFTTLSIEDKASVERVVQLTDKSIGYFNAGGFSAA
FT                   AGPGMENAVGGTDYDERALVSNMTVGSNYERHHEVQERFFTDRDERVVPP"
     MGFGQLVIGP PGSGKTTYCN GIQHFFQLTG RPCAVINLDP ANHDPPYECA VSVEELITLE        60
     EAQREFNLGP NGAMVYCIEY VSKNLDWLKE RVTPLVAEGK YVLFDLPGQV ELFNMHDALR       120
     EVVAAITGPE WNLRLCTVHL IDSHLCADPA KYIAALMLSL SSMLHLETPH VNVLSKVDLM       180
     DKYGELDFNL EYYADVMNLE YLADRILDGN QDAIGTAPSP GQTMMRKKYG KLTKGLCELV       240
     EDFGLVNFTT LSIEDKASVE RVVQLTDKSI GYFNAGGFSA AAGPGMENAV GGTDYDERAL       300
     VSNMTVGSNY ERHHEVQERF FTDRDERVVP P                                      331
//

If you have problems or comments...

PBIL Back to PBIL home page