(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE171

MICSR_1.PE171        Location/Qualifiers
FT   CDS             331059..332345
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636511"
FT                   /orf_name="MICPUN_56744"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61676.1"
FT                   /db_xref="UniParc:UPI000199A910"
FT                   /db_xref="UniProtKB/TrEMBL:C1E148"
FT                   /transl_table=1
FT                   /translation="MPPAGDDYEPTMGAVQLLVHRRLRTVQKRVAKIAKAEEKRSAGGE
FT                   IDDQQKELIDGKPLTMALLEEFTKLSQEVEKAVEEDRLAVLREERAKVAAKAERSAARR
FT                   AAAAGDRPDEATKANEASAAPPVPPVDGGATRTTGKKPGRRGGGRESPADGAAPPAREP
FT                   LASTPNQPPPAEIPQVVDAPAAAKPRRERGGRGKNRRREGDIGDADTRAAPAPGPGAGP
FT                   GGPPGGVFPGHQQGPFQQGPGAPVATVDGVSLRFGSLGVNGPPAGQSRPPDGSVATEEE
FT                   RARRPETVAATLPKPPVPVEMTPAEINLADYGFDDEYGAPDDLVDDNVFHVAPHVAPRF
FT                   DDVGGAPRVDSRARGDRSSAATGGQRPAGTRAAGHSSREKVGGGGERRDAGGRGRGGER
FT                   RDGGGGGGNRGGGRGGRGGRGGRGRPGVE"
     MPPAGDDYEP TMGAVQLLVH RRLRTVQKRV AKIAKAEEKR SAGGEIDDQQ KELIDGKPLT        60
     MALLEEFTKL SQEVEKAVEE DRLAVLREER AKVAAKAERS AARRAAAAGD RPDEATKANE       120
     ASAAPPVPPV DGGATRTTGK KPGRRGGGRE SPADGAAPPA REPLASTPNQ PPPAEIPQVV       180
     DAPAAAKPRR ERGGRGKNRR REGDIGDADT RAAPAPGPGA GPGGPPGGVF PGHQQGPFQQ       240
     GPGAPVATVD GVSLRFGSLG VNGPPAGQSR PPDGSVATEE ERARRPETVA ATLPKPPVPV       300
     EMTPAEINLA DYGFDDEYGA PDDLVDDNVF HVAPHVAPRF DDVGGAPRVD SRARGDRSSA       360
     ATGGQRPAGT RAAGHSSREK VGGGGERRDA GGRGRGGERR DGGGGGGNRG GGRGGRGGRG       420
     GRGRPGVE                                                                428
//

If you have problems or comments...

PBIL Back to PBIL home page