(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE172

MICSR_1.PE172        Location/Qualifiers
FT   CDS             complement(332425..333078)
FT                   /codon_start=1
FT                   /gene_family="HOG000100017" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636512"
FT                   /orf_name="MICPUN_56745"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62108.1"
FT                   /db_xref="HOGENOM:HBG717200"
FT                   /db_xref="UniParc:UPI000199A911"
FT                   /db_xref="UniProtKB/TrEMBL:C1E149"
FT                   /transl_table=1
FT                   /translation="MSTIWRPDLNEDPIVVKEESDDDHNPPAVNVEPPADDHEEDEKSE
FT                   DLAGKMSTIWRPNLDRLYASVAEMEGSESEEEEDASKQGTKRKRAPHTKGPCEHGVKWR
FT                   SQCKVCSACPHGKRRCHCKECGGASICEHGRIRSQCKECGGASICEHGRQRSKCKECGG
FT                   GSICEHGRHRQYCKECGGGSICEHGRRRSQCKECGGSGICKHGRRRSRCKECKK"
     MSTIWRPDLN EDPIVVKEES DDDHNPPAVN VEPPADDHEE DEKSEDLAGK MSTIWRPNLD        60
     RLYASVAEME GSESEEEEDA SKQGTKRKRA PHTKGPCEHG VKWRSQCKVC SACPHGKRRC       120
     HCKECGGASI CEHGRIRSQC KECGGASICE HGRQRSKCKE CGGGSICEHG RHRQYCKECG       180
     GGSICEHGRR RSQCKECGGS GICKHGRRRS RCKECKK                                217
//

If you have problems or comments...

PBIL Back to PBIL home page