(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE173

MICSR_1.PE173        Location/Qualifiers
FT   CDS             333290..334597
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636513"
FT                   /orf_name="MICPUN_56746"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61677.1"
FT                   /db_xref="UniParc:UPI000199A912"
FT                   /db_xref="UniProtKB/TrEMBL:C1E150"
FT                   /transl_table=1
FT                   /translation="MRPARAREEGRGGGARPPRGREREDMSRRPGGGGPGGRPGGRRGA
FT                   DGRPPRMPRQGPGGRGGPPIRQRYKKPPGLLSWYKPRVSHGFIAAFSLGILLMLALWTF
FT                   PSYSAYVDRAEMVKQYCLVHGGDNSTGCVKVEIVHESVCDPAVPELYGHLTTDNCTDLC
FT                   VYSDEERTVGNTTAAERLAFVDSFIPGAEVPCFYPPGDSNFTQATFTVPYNPNEQMFLS
FT                   LVWLSPLFFCLLVSVHCALRKPREALELEDDQMLTGLFNEVVIQRNHQEKFVNDVEMRV
FT                   KHLKSAVDGEQQKRLDVVLEVEKERRDRLTSEDNLKHALHENMRSLESKLVREMAQRLA
FT                   SIPIPSKLKEKMMRKADKYREDRDPLLGGRRSKNDRPDSAASLIFEDHQRNAERRRAAL
FT                   ANDLDAQRGAFKQRLEERKSKGKRSKSKDPGAKRRD"
     MRPARAREEG RGGGARPPRG REREDMSRRP GGGGPGGRPG GRRGADGRPP RMPRQGPGGR        60
     GGPPIRQRYK KPPGLLSWYK PRVSHGFIAA FSLGILLMLA LWTFPSYSAY VDRAEMVKQY       120
     CLVHGGDNST GCVKVEIVHE SVCDPAVPEL YGHLTTDNCT DLCVYSDEER TVGNTTAAER       180
     LAFVDSFIPG AEVPCFYPPG DSNFTQATFT VPYNPNEQMF LSLVWLSPLF FCLLVSVHCA       240
     LRKPREALEL EDDQMLTGLF NEVVIQRNHQ EKFVNDVEMR VKHLKSAVDG EQQKRLDVVL       300
     EVEKERRDRL TSEDNLKHAL HENMRSLESK LVREMAQRLA SIPIPSKLKE KMMRKADKYR       360
     EDRDPLLGGR RSKNDRPDSA ASLIFEDHQR NAERRRAALA NDLDAQRGAF KQRLEERKSK       420
     GKRSKSKDPG AKRRD                                                        435
//

If you have problems or comments...

PBIL Back to PBIL home page