(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE174

MICSR_1.PE174        Location/Qualifiers
FT   CDS             complement(334707..335657)
FT                   /codon_start=1
FT                   /gene_family="HOG000007498" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636514"
FT                   /orf_name="MICPUN_79549"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62109.1"
FT                   /db_xref="HOGENOM:HBG560027"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniParc:UPI000199A913"
FT                   /db_xref="UniProtKB/TrEMBL:C1E151"
FT                   /transl_table=1
FT                   /translation="MGTGSRHSKNAGTMGSENLTYHEKKALGFGTVKERLGKETVKDFD
FT                   ACGLGLQHALDPVVTPEGVLYDREHILQCLLHQKKDIARKMKTWEGEQARDAEKASAEE
FT                   EAKRLAELEKFELENKGGFVNYSASAGTSTATGTSDARIASSADVAATQDDKERMKTMK
FT                   AFWLPSKTPTAERKAEKPDTDTKCPTTLKKLRLKDLLAVKWTKVRKGEEIGGARYMCPV
FT                   TFKTFTNATKIVVLKPSGHAVSEEAWTKVVKDEGTYDGHRVKGVIRLQRGGSGFAGSGT
FT                   QVESKTEFMLGAGSGLADGRGQNRGATSKFGLRFN"
     MGTGSRHSKN AGTMGSENLT YHEKKALGFG TVKERLGKET VKDFDACGLG LQHALDPVVT        60
     PEGVLYDREH ILQCLLHQKK DIARKMKTWE GEQARDAEKA SAEEEAKRLA ELEKFELENK       120
     GGFVNYSASA GTSTATGTSD ARIASSADVA ATQDDKERMK TMKAFWLPSK TPTAERKAEK       180
     PDTDTKCPTT LKKLRLKDLL AVKWTKVRKG EEIGGARYMC PVTFKTFTNA TKIVVLKPSG       240
     HAVSEEAWTK VVKDEGTYDG HRVKGVIRLQ RGGSGFAGSG TQVESKTEFM LGAGSGLADG       300
     RGQNRGATSK FGLRFN                                                       316
//

If you have problems or comments...

PBIL Back to PBIL home page