(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE175

MICSR_1.PE175        Location/Qualifiers
FT   CDS             join(336145..336249,336409..338073)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636515"
FT                   /orf_name="MICPUN_56748"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61678.1"
FT                   /db_xref="UniParc:UPI000199A914"
FT                   /db_xref="UniProtKB/TrEMBL:C1E152"
FT                   /transl_table=1
FT                   /translation="MSRPGGVSRSRPANEGERDPKRPRIGGAPQNVETEDDDLQVICPP
FT                   VNPVQSEVNAIVAMAVAGGADPVAVEQMLAATLGDPTQVQATLAVLRAVAAGAQNRTTA
FT                   GITAAALSAMNAASGPNGQGNSLAANAVTAVLTRPPHADRPAIIRRCQVDACNKLDVGG
FT                   GKCTAHGGGKRCQVDGCNAGDRGGGKCISHGGGKRCQSDRCDAGAASGGKFCVTHGGGL
FT                   RCTEEGCDRVRKVRGKCAVHGGINKKKLCVVAGCSSKDLGGGLCKTHGGVRLCSHEGCN
FT                   KRAKARGACVQHDSREKICSHPGCAFPARARGKCKDHGGVVMKMCASEGCAAKAATGSD
FT                   RCRAHGGGKRCSHEGCEKMDAGRGFCVAHGGGKRCQVPNCTKGATRSSFCVAHGGGKRC
FT                   TFEGCDKPGHFKGLCAAHGGGKLCQAPDCKKWDAGFGFCRSHGGGKRCSVEGCTTPVKL
FT                   RGLCIKHGGGHTCSVEGCNRSAKTRSLCIEHGGVKLCKVPNCTKMDRGRGFCSKHGNLL
FT                   GLGGLKCTHEGCNKCAVSKGLCCEHGGVRRCQMKGCQKMDRNGGFCNAHQPGGPVPDAL
FT                   PPPGMTQLPGIMA"
     MSRPGGVSRS RPANEGERDP KRPRIGGAPQ NVETEDDDLQ VICPPVNPVQ SEVNAIVAMA        60
     VAGGADPVAV EQMLAATLGD PTQVQATLAV LRAVAAGAQN RTTAGITAAA LSAMNAASGP       120
     NGQGNSLAAN AVTAVLTRPP HADRPAIIRR CQVDACNKLD VGGGKCTAHG GGKRCQVDGC       180
     NAGDRGGGKC ISHGGGKRCQ SDRCDAGAAS GGKFCVTHGG GLRCTEEGCD RVRKVRGKCA       240
     VHGGINKKKL CVVAGCSSKD LGGGLCKTHG GVRLCSHEGC NKRAKARGAC VQHDSREKIC       300
     SHPGCAFPAR ARGKCKDHGG VVMKMCASEG CAAKAATGSD RCRAHGGGKR CSHEGCEKMD       360
     AGRGFCVAHG GGKRCQVPNC TKGATRSSFC VAHGGGKRCT FEGCDKPGHF KGLCAAHGGG       420
     KLCQAPDCKK WDAGFGFCRS HGGGKRCSVE GCTTPVKLRG LCIKHGGGHT CSVEGCNRSA       480
     KTRSLCIEHG GVKLCKVPNC TKMDRGRGFC SKHGNLLGLG GLKCTHEGCN KCAVSKGLCC       540
     EHGGVRRCQM KGCQKMDRNG GFCNAHQPGG PVPDALPPPG MTQLPGIMA                   589
//

If you have problems or comments...

PBIL Back to PBIL home page