(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE177

MICSR_1.PE177        Location/Qualifiers
FT   CDS             344602..345435
FT                   /codon_start=1
FT                   /gene_family="HOG000200395" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636517"
FT                   /orf_name="MICPUN_56751"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61679.1"
FT                   /db_xref="HOGENOM:HBG560030"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="UniParc:UPI000199A97D"
FT                   /db_xref="UniProtKB/TrEMBL:C1E154"
FT                   /transl_table=1
FT                   /translation="MREARDAEGPRRSFSLHRVSEHDRLVGEGRDVRILHVVRHAQGTH
FT                   NVDQKYRDPRNHDARLTGFGEQQCEALSRTPAAIEAQRSASLVVTSPLTRCVQTALLSF
FT                   PDIARREEVPFVALECIRETVNFACDGRRRRSEIAADFPRVNFSADDGVGDEDELWARY
FT                   ENLCGPTSAHDGHRESCDLPSVADRGRAFFAWLRRRPEREAIVSSHSAFLRCVFSWGQD
FT                   GGVRAAPDQALGESVWGELVDVNVPVVDYRGDVKLEYDLRRDWENCEMRTFLVAF"
     MREARDAEGP RRSFSLHRVS EHDRLVGEGR DVRILHVVRH AQGTHNVDQK YRDPRNHDAR        60
     LTGFGEQQCE ALSRTPAAIE AQRSASLVVT SPLTRCVQTA LLSFPDIARR EEVPFVALEC       120
     IRETVNFACD GRRRRSEIAA DFPRVNFSAD DGVGDEDELW ARYENLCGPT SAHDGHRESC       180
     DLPSVADRGR AFFAWLRRRP EREAIVSSHS AFLRCVFSWG QDGGVRAAPD QALGESVWGE       240
     LVDVNVPVVD YRGDVKLEYD LRRDWENCEM RTFLVAF                                277
//

If you have problems or comments...

PBIL Back to PBIL home page