(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE178

MICSR_1.PE178        Location/Qualifiers
FT   CDS             complement(345588..346661)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636518"
FT                   /orf_name="MICPUN_56752"
FT                   /product="Predicted protein"
FT                   /function="GTP cyclohydrolase II activity"
FT                   /biological_process="riboflavin biosynthetic process "
FT                   /protein_id="ACO62111.1"
FT                   /db_xref="GO:0003935"
FT                   /db_xref="GO:0009231"
FT                   /db_xref="HOGENOM:HBG735778"
FT                   /db_xref="InterPro:IPR000926"
FT                   /db_xref="UniParc:UPI000199A97E"
FT                   /db_xref="UniProtKB/TrEMBL:C1E155"
FT                   /transl_table=1
FT                   /translation="MSFAAVSTHAGAVASSRRAPVGMGASTLGEQRQVGRLVDHVAGRR
FT                   YRHRRFDVRWTASAGDPNNESRRRSLNSRNAPGHAHRRGPKPPSIDRVLRAMPELTPES
FT                   PKDKPVSTNAMSFDESSIGDTEFIAETKLPTGSGFYRLRGYRHSVDGGVPSEPVAICFG
FT                   DIEGREKVPVRVHDACFTSEVLGSLKCDCKQQLQLAMEYIQENDGMVIYLHQEGRGIGL
FT                   ANKIAAYALQDTQGLDTVDANRALGLPDDVREYTAVANILEDMGIRSIQLMTNNPRKVA
FT                   TLERLGVKIEGRIPCIVKANLFNQGYLEAKEGRMKHFLDGSWCYWDHSGNTFDEDDAAA
FT                   SGEGGGAEQGEPAAEEK"
     MSFAAVSTHA GAVASSRRAP VGMGASTLGE QRQVGRLVDH VAGRRYRHRR FDVRWTASAG        60
     DPNNESRRRS LNSRNAPGHA HRRGPKPPSI DRVLRAMPEL TPESPKDKPV STNAMSFDES       120
     SIGDTEFIAE TKLPTGSGFY RLRGYRHSVD GGVPSEPVAI CFGDIEGREK VPVRVHDACF       180
     TSEVLGSLKC DCKQQLQLAM EYIQENDGMV IYLHQEGRGI GLANKIAAYA LQDTQGLDTV       240
     DANRALGLPD DVREYTAVAN ILEDMGIRSI QLMTNNPRKV ATLERLGVKI EGRIPCIVKA       300
     NLFNQGYLEA KEGRMKHFLD GSWCYWDHSG NTFDEDDAAA SGEGGGAEQG EPAAEEK          357
//

If you have problems or comments...

PBIL Back to PBIL home page