(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE179

MICSR_1.PE179        Location/Qualifiers
FT   CDS             357736..359223
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636519"
FT                   /orf_name="MICPUN_107881"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61680.1"
FT                   /db_xref="UniParc:UPI000199A97F"
FT                   /db_xref="UniProtKB/TrEMBL:C1E156"
FT                   /transl_table=1
FT                   /translation="MAVTSTFGVTSDFTVNTDKFIVNATNGNTKMTGNLEMSGDTATLT
FT                   HSGSTGGLAISSAQHVDVESVRFTTNQIGSTGDPDLITLTDNKVSISGQTLEMSGSTSR
FT                   LQHTGTTSLAISSTNGHITIAGGSGDYVDVESVRFTDDYIGISGDTDIIRLTSTGSQAT
FT                   VAMVADVDVTGTMDVSSDFAVNTNSFKVTGTNGNTEILGSLTMKAVSGIITHDGASGSL
FT                   AISSSTGPVTIAGQSTGGYVDVESVRFTDNQIGINGDADIITLTSLSGTSTVAFANKIT
FT                   TGDLATLNSATVTTTLHSGGDLTVGTGPKLTVAASSGDVVTAGKIAVAGSHGDATKALY
FT                   VTGSVYATGAVTSASDSRFKRDVRSIHDPLAIVRSLEPVTFTFKRDAFPTRDFPVETQA
FT                   GFLAQDLERVLPHLVTEDDEGYKGVAYERLGVYAVAGVKALDESMERLDESMERLDESM
FT                   ERLQNDTVARLEARVVELERALAALVSRASGPTPAGR"
     MAVTSTFGVT SDFTVNTDKF IVNATNGNTK MTGNLEMSGD TATLTHSGST GGLAISSAQH        60
     VDVESVRFTT NQIGSTGDPD LITLTDNKVS ISGQTLEMSG STSRLQHTGT TSLAISSTNG       120
     HITIAGGSGD YVDVESVRFT DDYIGISGDT DIIRLTSTGS QATVAMVADV DVTGTMDVSS       180
     DFAVNTNSFK VTGTNGNTEI LGSLTMKAVS GIITHDGASG SLAISSSTGP VTIAGQSTGG       240
     YVDVESVRFT DNQIGINGDA DIITLTSLSG TSTVAFANKI TTGDLATLNS ATVTTTLHSG       300
     GDLTVGTGPK LTVAASSGDV VTAGKIAVAG SHGDATKALY VTGSVYATGA VTSASDSRFK       360
     RDVRSIHDPL AIVRSLEPVT FTFKRDAFPT RDFPVETQAG FLAQDLERVL PHLVTEDDEG       420
     YKGVAYERLG VYAVAGVKAL DESMERLDES MERLDESMER LQNDTVARLE ARVVELERAL       480
     AALVSRASGP TPAGR                                                        495
//

If you have problems or comments...

PBIL Back to PBIL home page