(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE18

MICSR_1.PE18         Location/Qualifiers
FT   CDS             join(33700..33732,33805..35230,35262..35266)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636023"
FT                   /orf_name="MICPUN_56589"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61593.1"
FT                   /db_xref="UniParc:UPI000199AAB4"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0P5"
FT                   /transl_table=1
FT                   /translation="MTELAVDRSLLVPTRGESSTQDENFGGYRLARDLLIEDRTEAHVL
FT                   ETPAMDSSAAMGKTLGRIAHLAASRRNQLFDLGIQRPDPGHDDCFAFASEGGVFHAVDV
FT                   PRNIDEPIKVSPINSIPIVATEDPAEGPRMGPSIARAANSNTFALSTGGGDLSVTSEGG
FT                   AVRGCEPPTFGEDGGRRPFVIESVTHRPGSMALLVWAVSTGAGAAVELFRLTVEESPDS
FT                   KAWTPTGAAVKVAEGTSPPLWCKVATSSSVDEVFVVAMETVEGRSVKAKSGEPVQEWLP
FT                   QDDEEAEEWIGNPGSAMVPSDGRGMAAWKAFNAEGDSEDEDDDAPRNPFDADLEDGPLH
FT                   VLMVSAWSDEVKTTARMPRNKPCAIVHGGAHIGVSHGVHCLTVSVEADGSARHVSTNQA
FT                   LSYVAKGKPNRKFVLATPDGTCAAVVETKRSSFVYRTPAPAPNPPKSGLHQIFDLTEKV
FT                   GSKLRGLPAGGVARQNSAEAPVLGARLVC"
     MTELAVDRSL LVPTRGESST QDENFGGYRL ARDLLIEDRT EAHVLETPAM DSSAAMGKTL        60
     GRIAHLAASR RNQLFDLGIQ RPDPGHDDCF AFASEGGVFH AVDVPRNIDE PIKVSPINSI       120
     PIVATEDPAE GPRMGPSIAR AANSNTFALS TGGGDLSVTS EGGAVRGCEP PTFGEDGGRR       180
     PFVIESVTHR PGSMALLVWA VSTGAGAAVE LFRLTVEESP DSKAWTPTGA AVKVAEGTSP       240
     PLWCKVATSS SVDEVFVVAM ETVEGRSVKA KSGEPVQEWL PQDDEEAEEW IGNPGSAMVP       300
     SDGRGMAAWK AFNAEGDSED EDDDAPRNPF DADLEDGPLH VLMVSAWSDE VKTTARMPRN       360
     KPCAIVHGGA HIGVSHGVHC LTVSVEADGS ARHVSTNQAL SYVAKGKPNR KFVLATPDGT       420
     CAAVVETKRS SFVYRTPAPA PNPPKSGLHQ IFDLTEKVGS KLRGLPAGGV ARQNSAEAPV       480
     LGARLVC                                                                 487
//

If you have problems or comments...

PBIL Back to PBIL home page