(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE181

MICSR_1.PE181        Location/Qualifiers
FT   CDS             complement(360631..361968)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636521"
FT                   /orf_name="MICPUN_56754"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62112.1"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000199A981"
FT                   /db_xref="UniProtKB/TrEMBL:C1E158"
FT                   /transl_table=1
FT                   /translation="MGVDPGDLLSLVPRDVLVKHMFADFAPIELLICSRVCHSWRTVFI
FT                   ESGLLPLPDRCELLDSIQVLVRSVSLLKWARSNARSWMEGERLQQIMILAAAEGRLDTL
FT                   RWLSSEGYRIHSKCLSDLVFAAASGAHQETLEWLWVVDNMRSLAIPESFKGTPEFNSDE
FT                   YDEYDECISLDHWRDIWFIVAVQGSGSSGNIEFAVWVRNFAASVGHTIDLHLEEDCLVR
FT                   AIHEKHVHFIKWRRGMFEKFNDQTRRTLCWEAAREGSVEILTFLLEECRWNTVFDDYGD
FT                   LYRAAIFYNPDVDHQPILSYLYEKGHGFDSRATVAAAFVGNLDTLEWLRARGCPWNSNV
FT                   VENAAEKGHLHILEYALDHGCDGGAWVFCYAARGGHIQVMEWAMARGLEWDERTCFSAA
FT                   KRGHLDALKWLRARGCPWDRWTRVYAERGRHTELLQWAIDNGAPPP"
     MGVDPGDLLS LVPRDVLVKH MFADFAPIEL LICSRVCHSW RTVFIESGLL PLPDRCELLD        60
     SIQVLVRSVS LLKWARSNAR SWMEGERLQQ IMILAAAEGR LDTLRWLSSE GYRIHSKCLS       120
     DLVFAAASGA HQETLEWLWV VDNMRSLAIP ESFKGTPEFN SDEYDEYDEC ISLDHWRDIW       180
     FIVAVQGSGS SGNIEFAVWV RNFAASVGHT IDLHLEEDCL VRAIHEKHVH FIKWRRGMFE       240
     KFNDQTRRTL CWEAAREGSV EILTFLLEEC RWNTVFDDYG DLYRAAIFYN PDVDHQPILS       300
     YLYEKGHGFD SRATVAAAFV GNLDTLEWLR ARGCPWNSNV VENAAEKGHL HILEYALDHG       360
     CDGGAWVFCY AARGGHIQVM EWAMARGLEW DERTCFSAAK RGHLDALKWL RARGCPWDRW       420
     TRVYAERGRH TELLQWAIDN GAPPP                                             445
//

If you have problems or comments...

PBIL Back to PBIL home page