(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE182

MICSR_1.PE182        Location/Qualifiers
FT   CDS             362071..363294
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636522"
FT                   /orf_name="MICPUN_99342"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61682.1"
FT                   /db_xref="UniParc:UPI000199A982"
FT                   /db_xref="UniProtKB/TrEMBL:C1E159"
FT                   /transl_table=1
FT                   /translation="MRRLHVQRLLLCCALLLLPNARALWFSMPPECDGRCWEEDVKHPL
FT                   ASCDLEVVEGAITPEEADDVVAAAEAHAAVHGWHSQRHIAYPTRDLPWTALPSVARVFD
FT                   KLWGAMEESVRRRCGVRPIDRLTPNDIFVVKYTPEGQAGLDRHRDASSFSFNAALSDPT
FT                   SYGGGGTRVWLDSAVRTLREKYLRAELEGVVRDGTAPGASAEARGAAARAEATLDRPPG
FT                   TLDVDGYVVRPDRLLPEDGETRKIAKGSVMVHGGRNVHEGTAIVSGTRHIVAGFVGLNR
FT                   HCCTLRYSGWRGVMALVRVTAMNNSARGGVRDKVGGRVPLWDYVLYEEWRGVFRWIRGA
FT                   SLVLALLSLAAYAAWHVATRLSPRFNLAARRALAVVAGYESSFFRGLARKRRRAMRSAL
FT                   PTKHSLDD"
     MRRLHVQRLL LCCALLLLPN ARALWFSMPP ECDGRCWEED VKHPLASCDL EVVEGAITPE        60
     EADDVVAAAE AHAAVHGWHS QRHIAYPTRD LPWTALPSVA RVFDKLWGAM EESVRRRCGV       120
     RPIDRLTPND IFVVKYTPEG QAGLDRHRDA SSFSFNAALS DPTSYGGGGT RVWLDSAVRT       180
     LREKYLRAEL EGVVRDGTAP GASAEARGAA ARAEATLDRP PGTLDVDGYV VRPDRLLPED       240
     GETRKIAKGS VMVHGGRNVH EGTAIVSGTR HIVAGFVGLN RHCCTLRYSG WRGVMALVRV       300
     TAMNNSARGG VRDKVGGRVP LWDYVLYEEW RGVFRWIRGA SLVLALLSLA AYAAWHVATR       360
     LSPRFNLAAR RALAVVAGYE SSFFRGLARK RRRAMRSALP TKHSLDD                     407
//

If you have problems or comments...

PBIL Back to PBIL home page