(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE184

MICSR_1.PE184        Location/Qualifiers
FT   CDS             complement(364807..365370)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636524"
FT                   /orf_name="MICPUN_107882"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62114.1"
FT                   /db_xref="UniParc:UPI000199A984"
FT                   /db_xref="UniProtKB/TrEMBL:C1E161"
FT                   /transl_table=1
FT                   /translation="MRNKGRSRRLAAAANSADAASAEATSPTSPGAGADDDEVRQPFAA
FT                   SDRVGSRAGSGAGTGPSDADTTSGDVRLNMFASSEHVGGEGDEGFRGDGATTPVEARGV
FT                   ETLAVLDEQQLWAMGLLGDEQIETKNMSREGSAHSEIGYEPAAWVDSETCQLVPELRNE
FT                   LLELMHQKRARSTEPEDVDDYLVL"
     MRNKGRSRRL AAAANSADAA SAEATSPTSP GAGADDDEVR QPFAASDRVG SRAGSGAGTG        60
     PSDADTTSGD VRLNMFASSE HVGGEGDEGF RGDGATTPVE ARGVETLAVL DEQQLWAMGL       120
     LGDEQIETKN MSREGSAHSE IGYEPAAWVD SETCQLVPEL RNELLELMHQ KRARSTEPED       180
     VDDYLVL                                                                 187
//

If you have problems or comments...

PBIL Back to PBIL home page