(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE185

MICSR_1.PE185        Location/Qualifiers
FT   CDS             366970..371157
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636525"
FT                   /orf_name="MICPUN_56758"
FT                   /product="Predicted protein"
FT                   /function="protein transporter activity"
FT                   /biological_process="intracellular protein transport "
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO61683.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0008565"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR006955"
FT                   /db_xref="UniParc:UPI000199A985"
FT                   /db_xref="UniProtKB/TrEMBL:C1E162"
FT                   /transl_table=1
FT                   /translation="MRRLFGGLGARGASGEKPKKPIRANLGDESSFYYDEKLKSWVDRN
FT                   DKSGAAGGGGGDGDASSLPPPPTSAPPTPAMPIRPSSTAASSTNGGDGDGSTAPGSNPL
FT                   SRSNSLSHVRNRYVDVFAGAASTAVSSGASTPGMTPATGSAANLLAPVLPGSFVPAPAG
FT                   ANGGATSGATAATQSGGTAGAPKFFVPAVPSQSSMTETSAEDDDDDADGVGGQVSGAHA
FT                   GGPRGGATGGAGVGRLGLDRLIVPDEGTTMLRGEGATVSPKAAKGGHHHARGPTLTAIA
FT                   TGGGAREEDTDPRNGPSGVGGDALGSSEDASGPFGSPPRRRGDDARDSKSRLGDWAQAL
FT                   GRVSEGMSSPKAAASARVSENFAPDEPAASAFSGSGGGFSDAVGGGAGSGDEPRVAPGG
FT                   FFVPTSGGSGGPSTTDDAGTSNARSLLGGDDGLLGEPALLQPAGDGGGGGKRRGGGGGR
FT                   DSVDAGAAPEELPDVPADLTYSERRERERLARLSGNAGYGVPDGTSTSPVKAPTYGAGA
FT                   YGGAYQDEYREYSDGYGDGARFGYDAATAEPSLDYQQGYEQQQQQQQQQQQQQQIQDGD
FT                   VTWSQDEQGNWWYQYPGQEAAMYVDPSVAATGGGGEGSSETVAAFDDAAGAILGAETID
FT                   PDPVALPGAETIDPPPSSGVLEILPDPEPEARVQPTTAEPEARDPSATAPAFAASGGGG
FT                   GGDGTLEPPPVVGGSDLPPPPTRAAPAPGAPPNPEDFKTDEDYDRAWQEALDAAYADAN
FT                   EAERREKIASAALEDAEAALASAKSENEAFRRELETVRAAAEASAAGAREDATAARSEL
FT                   EALRLELEGARATIEEARAEAASSRERQKQVVSSDDAGGDDGMPGGDGGDAAGDAAQSA
FT                   RAAGYRAGHADGYREGHAAATADGDEQMEDLLVCLGQEERKTERLRELLEANGVDTAPI
FT                   MAELEAEAEANMAAQMLGGGDTTAADDEETQDEVEDGPAQLDAGGEPPVREVTRSDADV
FT                   HVDDTSFASSVAFMTDASALDPPGAAGVRGFGFGPTRGVGGANGEGLTTTPAPGYGYGD
FT                   VSIDGSIHGVEVSGMASVPDTPTAGGAAVLRDISLPDIPAFRVGDEPEPEPEPEPEPEP
FT                   KEPDLPSAFGGDDDGWRDGDDGWNRDDEWNISGEIARDGEAAQNISGWDLNSPMPPGLE
FT                   AAPPPTAPPPMAPPPVAVAAPPPMAAPPMAPPPMAPPPMAAAAPPPVAPPPMAPPPMAA
FT                   AAPPPMAAPPMAPPPAAVATVPFGSPFDDAVDAGDDVAFFNQFNADVQPMVPAQPMVPA
FT                   QYQQHQQPHHQEHQHQHHHQQHHHQQHQQQADVYSFAPVQPQAHHYYGYDQAAQQQQQQ
FT                   QQQQHQQAGYYQQHQPPGQAQVQTPVNDSAMHAHTPGGLHYQAYPPAPGKWD"
     MRRLFGGLGA RGASGEKPKK PIRANLGDES SFYYDEKLKS WVDRNDKSGA AGGGGGDGDA        60
     SSLPPPPTSA PPTPAMPIRP SSTAASSTNG GDGDGSTAPG SNPLSRSNSL SHVRNRYVDV       120
     FAGAASTAVS SGASTPGMTP ATGSAANLLA PVLPGSFVPA PAGANGGATS GATAATQSGG       180
     TAGAPKFFVP AVPSQSSMTE TSAEDDDDDA DGVGGQVSGA HAGGPRGGAT GGAGVGRLGL       240
     DRLIVPDEGT TMLRGEGATV SPKAAKGGHH HARGPTLTAI ATGGGAREED TDPRNGPSGV       300
     GGDALGSSED ASGPFGSPPR RRGDDARDSK SRLGDWAQAL GRVSEGMSSP KAAASARVSE       360
     NFAPDEPAAS AFSGSGGGFS DAVGGGAGSG DEPRVAPGGF FVPTSGGSGG PSTTDDAGTS       420
     NARSLLGGDD GLLGEPALLQ PAGDGGGGGK RRGGGGGRDS VDAGAAPEEL PDVPADLTYS       480
     ERRERERLAR LSGNAGYGVP DGTSTSPVKA PTYGAGAYGG AYQDEYREYS DGYGDGARFG       540
     YDAATAEPSL DYQQGYEQQQ QQQQQQQQQQ QIQDGDVTWS QDEQGNWWYQ YPGQEAAMYV       600
     DPSVAATGGG GEGSSETVAA FDDAAGAILG AETIDPDPVA LPGAETIDPP PSSGVLEILP       660
     DPEPEARVQP TTAEPEARDP SATAPAFAAS GGGGGGDGTL EPPPVVGGSD LPPPPTRAAP       720
     APGAPPNPED FKTDEDYDRA WQEALDAAYA DANEAERREK IASAALEDAE AALASAKSEN       780
     EAFRRELETV RAAAEASAAG AREDATAARS ELEALRLELE GARATIEEAR AEAASSRERQ       840
     KQVVSSDDAG GDDGMPGGDG GDAAGDAAQS ARAAGYRAGH ADGYREGHAA ATADGDEQME       900
     DLLVCLGQEE RKTERLRELL EANGVDTAPI MAELEAEAEA NMAAQMLGGG DTTAADDEET       960
     QDEVEDGPAQ LDAGGEPPVR EVTRSDADVH VDDTSFASSV AFMTDASALD PPGAAGVRGF      1020
     GFGPTRGVGG ANGEGLTTTP APGYGYGDVS IDGSIHGVEV SGMASVPDTP TAGGAAVLRD      1080
     ISLPDIPAFR VGDEPEPEPE PEPEPEPKEP DLPSAFGGDD DGWRDGDDGW NRDDEWNISG      1140
     EIARDGEAAQ NISGWDLNSP MPPGLEAAPP PTAPPPMAPP PVAVAAPPPM AAPPMAPPPM      1200
     APPPMAAAAP PPVAPPPMAP PPMAAAAPPP MAAPPMAPPP AAVATVPFGS PFDDAVDAGD      1260
     DVAFFNQFNA DVQPMVPAQP MVPAQYQQHQ QPHHQEHQHQ HHHQQHHHQQ HQQQADVYSF      1320
     APVQPQAHHY YGYDQAAQQQ QQQQQQQHQQ AGYYQQHQPP GQAQVQTPVN DSAMHAHTPG      1380
     GLHYQAYPPA PGKWD                                                       1395
//

If you have problems or comments...

PBIL Back to PBIL home page