(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE186

MICSR_1.PE186        Location/Qualifiers
FT   CDS             complement(371270..373858)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636526"
FT                   /orf_name="MICPUN_56759"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="ACO62115.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="UniParc:UPI000199A986"
FT                   /db_xref="UniProtKB/TrEMBL:C1E163"
FT                   /transl_table=1
FT                   /translation="MPNTRKTEVIKQEANGTAGDVASVKKVDSVTNLLSPLPSIEKVAS
FT                   FGLTPNPSGNPPLNPAVNAMKKSGSGLATSASPSADAAGAGGRPVDSGVTSSGATGSDA
FT                   NALGSGFRPIKRSRRSSENHDKDVNVRDFEGVDLAGISRRFPQEKRVQLAQRIDEHAEK
FT                   VAGAWAALLLAQTGMRYAEWATTASRVEQTKQNTLRIVKAIVDYLTTASQAKLRQTISY
FT                   IVAKRRRQGFGHEEVITSMLLLRRSFEKGCGPIDGEAGFLIDAVTRVMVGEVATYLHAI
FT                   NPHEESQLDVCVATEDDDELGVEHPEDLNLPPQRHLQQDLEDVRPPMHLFIVPKVPAQY
FT                   VRAREGGTPIMLAPLWSRAAHEPSGLWTWPRGTEPLVGAIVNNRFVVEAYIASGSYGHG
FT                   WKAVDLHSKKPVFLKTPRASHDYMPSDMMGELARELGTMRRILHTIPKHPRLVNVIEVT
FT                   PPHAPKPCATSCGVTAPIHYFACDLCEGGDLFGYISTQPLEPMREPVVAHIFRQLMEAL
FT                   EFLHGRNLFHRDLKTENMLVSREEGRYSLKVADFGRTVFVPPQPSETGEGPTNIHEQFS
FT                   YDNGIFPAEAVRGGMIGDEVMAAEDGMYRLPSADVWAAGLVLLLLTGVGRMSKIKHNIA
FT                   DALRGRGERFAPLSKDETPIDRLYRLIGPGWQVSPELDQLFRAMVHKDPMMRPSAEEVL
FT                   ACDWMKKADEVTEAEVVAAFESRRPVSEEAHNTMSVTCAPRLKDTATAFDALIEALQSL
FT                   EWPTAGNDVRAEVHVDRDRLTATCVMDEMRIRAILTPVEGLLEKNPTVNMFKEGEGEAD
FT                   PVAAAKRMEAARRERENNQTPIVRLVWIGGSAGAMQLVNVYMAVSAMLST"
     MPNTRKTEVI KQEANGTAGD VASVKKVDSV TNLLSPLPSI EKVASFGLTP NPSGNPPLNP        60
     AVNAMKKSGS GLATSASPSA DAAGAGGRPV DSGVTSSGAT GSDANALGSG FRPIKRSRRS       120
     SENHDKDVNV RDFEGVDLAG ISRRFPQEKR VQLAQRIDEH AEKVAGAWAA LLLAQTGMRY       180
     AEWATTASRV EQTKQNTLRI VKAIVDYLTT ASQAKLRQTI SYIVAKRRRQ GFGHEEVITS       240
     MLLLRRSFEK GCGPIDGEAG FLIDAVTRVM VGEVATYLHA INPHEESQLD VCVATEDDDE       300
     LGVEHPEDLN LPPQRHLQQD LEDVRPPMHL FIVPKVPAQY VRAREGGTPI MLAPLWSRAA       360
     HEPSGLWTWP RGTEPLVGAI VNNRFVVEAY IASGSYGHGW KAVDLHSKKP VFLKTPRASH       420
     DYMPSDMMGE LARELGTMRR ILHTIPKHPR LVNVIEVTPP HAPKPCATSC GVTAPIHYFA       480
     CDLCEGGDLF GYISTQPLEP MREPVVAHIF RQLMEALEFL HGRNLFHRDL KTENMLVSRE       540
     EGRYSLKVAD FGRTVFVPPQ PSETGEGPTN IHEQFSYDNG IFPAEAVRGG MIGDEVMAAE       600
     DGMYRLPSAD VWAAGLVLLL LTGVGRMSKI KHNIADALRG RGERFAPLSK DETPIDRLYR       660
     LIGPGWQVSP ELDQLFRAMV HKDPMMRPSA EEVLACDWMK KADEVTEAEV VAAFESRRPV       720
     SEEAHNTMSV TCAPRLKDTA TAFDALIEAL QSLEWPTAGN DVRAEVHVDR DRLTATCVMD       780
     EMRIRAILTP VEGLLEKNPT VNMFKEGEGE ADPVAAAKRM EAARRERENN QTPIVRLVWI       840
     GGSAGAMQLV NVYMAVSAML ST                                                862
//

If you have problems or comments...

PBIL Back to PBIL home page