(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE188

MICSR_1.PE188        Location/Qualifiers
FT   CDS             join(complement(380306..380458),complement(377344..380199))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636528"
FT                   /orf_name="MICPUN_56761"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62116.1"
FT                   /db_xref="UniParc:UPI000199A9EB"
FT                   /db_xref="UniProtKB/TrEMBL:C1E165"
FT                   /transl_table=1
FT                   /translation="MGSEGAGAPPAPLRPEECLDLDLWDHIFDDAAVAKRSPLRTLARD
FT                   MRAQLEIAEKALPRTAERDALLAKLEDIAEAASRDVTLLVADWRGIEGSVVADDDETNG
FT                   TPAGKGLEHLPLQEGLPPGVNVVTRVGTVTRAALADADALALILDEHQAASAEETTTPS
FT                   VAAPYSSDAPRADETPEREEGSRQTPASSTDEGAIEGEAREGEGDDAAVTTVTTAGADA
FT                   AQLARECVKRAGEFSVFIAVEADQRPPELRFDRAAGPPTADQPEEPETPPPLDAAAAEG
FT                   SGEGHSGAGDEEPGANPLESFEAFGSWFNKMVETAADQFTGNNDDDGSSDDDGEDLSDG
FT                   GDAAAGMVKSSGPKSPEKKPAAKREKRDSESERKERERKEREAEALRRYKPKRPRDAAN
FT                   GLAARCGVRAGRILSVATMHLVPPPGGFARTAGGAAEGTAGGDDDSDAGPDGDGSKPLQ
FT                   REGGEGETEAEKAERERNAAERARAMSELYRKMMDEQDRGEGPSDDGDKTDGGDDRTGG
FT                   EGGDLTNYVDDAEIEAMLGETEAANNWSKVTDREYAWVKAVGKTCQAIMVEKTLGLIER
FT                   YAPLRAYVRYWAAVVRADETLSNHADAAEQAKAVAANTLGRILTSAAEGMPNVGFVGAA
FT                   ELAALHRRRDPSISAGWLKALIYGDSTMSFTGGTILSLGGPAAAPVTAPPALAMYFTIR
FT                   LRLCLAIAALGGCDVLGPEAGAATLACFFGTDARELLDARPRVEELDALIAAANDAAAG
FT                   GADGGNGPGRSSSWLPDVSGAMSRVFKAGASAQRVAQRCAAGYAARASAHVARRAAMGR
FT                   ETFQSGTGDVDADCTRAYEVAYQRALPREMVRAMGEHVFTAANMVVVAAELVPFVSSYL
FT                   TVRAANAAIKCHLPHLAPAAEAELENAKDSADANAAAATPSGGWTKDITDGASKVANSV
FT                   GAAASEAAARTSAAAAAAGAGIASLWSKASETAASSIKVTGLVREGGTEPVPRLSDPDA
FT                   LRTFVSTGSGGVV"
     MGSEGAGAPP APLRPEECLD LDLWDHIFDD AAVAKRSPLR TLARDMRAQL EIAEKALPRT        60
     AERDALLAKL EDIAEAASRD VTLLVADWRG IEGSVVADDD ETNGTPAGKG LEHLPLQEGL       120
     PPGVNVVTRV GTVTRAALAD ADALALILDE HQAASAEETT TPSVAAPYSS DAPRADETPE       180
     REEGSRQTPA SSTDEGAIEG EAREGEGDDA AVTTVTTAGA DAAQLARECV KRAGEFSVFI       240
     AVEADQRPPE LRFDRAAGPP TADQPEEPET PPPLDAAAAE GSGEGHSGAG DEEPGANPLE       300
     SFEAFGSWFN KMVETAADQF TGNNDDDGSS DDDGEDLSDG GDAAAGMVKS SGPKSPEKKP       360
     AAKREKRDSE SERKERERKE REAEALRRYK PKRPRDAANG LAARCGVRAG RILSVATMHL       420
     VPPPGGFART AGGAAEGTAG GDDDSDAGPD GDGSKPLQRE GGEGETEAEK AERERNAAER       480
     ARAMSELYRK MMDEQDRGEG PSDDGDKTDG GDDRTGGEGG DLTNYVDDAE IEAMLGETEA       540
     ANNWSKVTDR EYAWVKAVGK TCQAIMVEKT LGLIERYAPL RAYVRYWAAV VRADETLSNH       600
     ADAAEQAKAV AANTLGRILT SAAEGMPNVG FVGAAELAAL HRRRDPSISA GWLKALIYGD       660
     STMSFTGGTI LSLGGPAAAP VTAPPALAMY FTIRLRLCLA IAALGGCDVL GPEAGAATLA       720
     CFFGTDAREL LDARPRVEEL DALIAAANDA AAGGADGGNG PGRSSSWLPD VSGAMSRVFK       780
     AGASAQRVAQ RCAAGYAARA SAHVARRAAM GRETFQSGTG DVDADCTRAY EVAYQRALPR       840
     EMVRAMGEHV FTAANMVVVA AELVPFVSSY LTVRAANAAI KCHLPHLAPA AEAELENAKD       900
     SADANAAAAT PSGGWTKDIT DGASKVANSV GAAASEAAAR TSAAAAAAGA GIASLWSKAS       960
     ETAASSIKVT GLVREGGTEP VPRLSDPDAL RTFVSTGSGG VV                         1002
//

If you have problems or comments...

PBIL Back to PBIL home page