(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE189

MICSR_1.PE189        Location/Qualifiers
FT   CDS             complement(380608..381921)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636529"
FT                   /orf_name="MICPUN_56762"
FT                   /product="Predicted protein"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO62117.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR001395"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="UniParc:UPI000199A9EC"
FT                   /db_xref="UniProtKB/TrEMBL:C1E166"
FT                   /transl_table=1
FT                   /translation="MRLAHAMRASRGSPGRGPGAARAAKGETRRPGEGPAPAKASPHPR
FT                   THRLGRADRGERRRLGDSDLRVSLASLDASTWTRIGDEVEAHAQLSLAVDNGVNLVDLG
FT                   SCDHLGDGMPRSASSSSSSSATIFELTRGRADAYLGSWLRRSRDTRREDLVVAASVPFG
FT                   AAAGAAEGGAKGRRRRIKNLVERTLMAADTDHVDLLQLHYPRRDSSAMGNSDAPDEDEV
FT                   AALLDLVGDGKARFLGVDDDTRWAALETARLFANPKILVPDGLGSFVKSARGEYNLLAR
FT                   DGFECVWVEGEDAYADALRNVGLVAHSPLANGALRSRRTAVHKSHADATTAKMIQTRGE
FT                   RGARDESVWALVDAYEEVAGQFGMCLGDLALGFVRSRWFVTSVCVRARTSDALGTTLAQ
FT                   LYDIEVTEEALAEVERVARLGRVAEEVDRGRRRWSQEL"
     MRLAHAMRAS RGSPGRGPGA ARAAKGETRR PGEGPAPAKA SPHPRTHRLG RADRGERRRL        60
     GDSDLRVSLA SLDASTWTRI GDEVEAHAQL SLAVDNGVNL VDLGSCDHLG DGMPRSASSS       120
     SSSSATIFEL TRGRADAYLG SWLRRSRDTR REDLVVAASV PFGAAAGAAE GGAKGRRRRI       180
     KNLVERTLMA ADTDHVDLLQ LHYPRRDSSA MGNSDAPDED EVAALLDLVG DGKARFLGVD       240
     DDTRWAALET ARLFANPKIL VPDGLGSFVK SARGEYNLLA RDGFECVWVE GEDAYADALR       300
     NVGLVAHSPL ANGALRSRRT AVHKSHADAT TAKMIQTRGE RGARDESVWA LVDAYEEVAG       360
     QFGMCLGDLA LGFVRSRWFV TSVCVRARTS DALGTTLAQL YDIEVTEEAL AEVERVARLG       420
     RVAEEVDRGR RRWSQEL                                                      437
//

If you have problems or comments...

PBIL Back to PBIL home page