(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE19

MICSR_1.PE19         Location/Qualifiers
FT   CDS             join(complement(36651..36682),complement(36455..36527),
FT                   complement(35367..36311))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636024"
FT                   /orf_name="MICPUN_56590"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62038.1"
FT                   /db_xref="UniParc:UPI000199AAB5"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0P6"
FT                   /transl_table=1
FT                   /translation="MAKGKGADRRKSIFGSKTPAPQVPLEPVNVNSTRQAQLASEPRAT
FT                   RGMARTGKEVVVEDGFKYKRRKNKDTKAAGAGPGSNFAALGRRSTGGDEEILSEVERLR
FT                   SLDPATVFAPDDPAWTLHENIPEDLPESERLQMLIEEICELEMKRERERLVEELGPEAG
FT                   AEAAKSLEDALSEFQLKVEEMIVRGEIKFANDGDAGADLKDAKHEAMAAVLSQLEDEKA
FT                   QWDALEQEALAGASADDEASMEQMRKDVEEVNKAVEALIAAELAAENGEGGTAEELAKA
FT                   VEEAERKLAMQQEGLSALVEGVEALCTRAERAAEVFSKAIAENDFKGLPHVNSPQNLVK
FT                   NLVRGKTKK"
     MAKGKGADRR KSIFGSKTPA PQVPLEPVNV NSTRQAQLAS EPRATRGMAR TGKEVVVEDG        60
     FKYKRRKNKD TKAAGAGPGS NFAALGRRST GGDEEILSEV ERLRSLDPAT VFAPDDPAWT       120
     LHENIPEDLP ESERLQMLIE EICELEMKRE RERLVEELGP EAGAEAAKSL EDALSEFQLK       180
     VEEMIVRGEI KFANDGDAGA DLKDAKHEAM AAVLSQLEDE KAQWDALEQE ALAGASADDE       240
     ASMEQMRKDV EEVNKAVEAL IAAELAAENG EGGTAEELAK AVEEAERKLA MQQEGLSALV       300
     EGVEALCTRA ERAAEVFSKA IAENDFKGLP HVNSPQNLVK NLVRGKTKK                   349
//

If you have problems or comments...

PBIL Back to PBIL home page