(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE190

MICSR_1.PE190        Location/Qualifiers
FT   CDS             382228..383127
FT                   /codon_start=1
FT                   /gene_family="HOG000265292" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636530"
FT                   /orf_name="MICPUN_107885"
FT                   /product="Predicted protein"
FT                   /function="catalytic activity"
FT                   /protein_id="ACO61685.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG319334"
FT                   /db_xref="InterPro:IPR006992"
FT                   /db_xref="UniParc:UPI000199A9ED"
FT                   /db_xref="UniProtKB/TrEMBL:C1E167"
FT                   /transl_table=1
FT                   /translation="MAMASSGEAARPSVIDAHLHVWPSPSAYTYAEGKAPPDSLAEVSS
FT                   AESLLEQFAKAGVDGALVVQPINLKFDHSYVSSVIDKYPGKFVGCCLADPTEHGGGVDE
FT                   LRRLLDGGYRAVRFNPGLWPSGTKMTDRVGREMFALCGERNAPVGFMCFHGLDLSIEEI
FT                   ETLCTDYPETPVLMDHFGFCKGVRDPNWQKLLGLARFPQVSVKASAQFRVTPEGANGAS
FT                   WPYVSTGEQLRELIDTFGAERVVWGSDFPFVLEQCGYSGETPAAGIIRECGARLSDEEM
FT                   AAVMGGNLRRMFPGAWSR"
     MAMASSGEAA RPSVIDAHLH VWPSPSAYTY AEGKAPPDSL AEVSSAESLL EQFAKAGVDG        60
     ALVVQPINLK FDHSYVSSVI DKYPGKFVGC CLADPTEHGG GVDELRRLLD GGYRAVRFNP       120
     GLWPSGTKMT DRVGREMFAL CGERNAPVGF MCFHGLDLSI EEIETLCTDY PETPVLMDHF       180
     GFCKGVRDPN WQKLLGLARF PQVSVKASAQ FRVTPEGANG ASWPYVSTGE QLRELIDTFG       240
     AERVVWGSDF PFVLEQCGYS GETPAAGIIR ECGARLSDEE MAAVMGGNLR RMFPGAWSR        299
//

If you have problems or comments...

PBIL Back to PBIL home page