(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE191

MICSR_1.PE191        Location/Qualifiers
FT   CDS             complement(383200..386064)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636531"
FT                   /orf_name="MICPUN_99349"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62118.1"
FT                   /db_xref="UniParc:UPI000199A9EE"
FT                   /db_xref="UniProtKB/TrEMBL:C1E168"
FT                   /transl_table=1
FT                   /translation="MQAPWVRPSTRSVGVTSTPRARCAVASSSTRATGEPSPRRCAPDR
FT                   RGGARDGRTTTIFSATTAIVPLAVAPPRRSTGRRGADFSRRGPVSLRARRARFAVVPDA
FT                   GDGETVPGGGDDDGTSDDSDPSSANQGDDRGGIVDEATEETEEEDEEDEYEEVEVEVDY
FT                   TVLDHARDAIDSLGTWSDVAGWGDDQSVTNRETSRGVGGAAGTSSFKSAATAPVSAAPG
FT                   GKLGMAPTDGVVVALAFTIGALFGRRQAEAGGASRGLAELVKSGNGGAVPGGVELRPMT
FT                   EEERIADEKRRAERRAEKERREAEATKKRKEDEAKFLAAEKKRLEKEAAEAERVRVAEE
FT                   ERRAKVRAELAERAEIERAIREEKEAKEREERERREREAEEELRKRREEEARVAAERLA
FT                   AMNAEKERRGETLKGFDVAASVTYEYRAGAGDVEVEVRARCGISSPATISDAFPTSEKA
FT                   RRGALEMCSAVAKSAVANFASDQRVRRMTGETDRCLIGVDPVTGAGFDDAEFDHWMRVS
FT                   QARTDAELRTLVMRGGAAMELKIRQPGGASNNQRETSELEFRPERASLPSADADNVANR
FT                   LTAAAAAALDNAYGVATEDLDWVARYELSALHGLDASLCFPAVSEGDGDKNRLKGTVTA
FT                   TMLTLSHWIARAKMNLASAGDAGPGLAAVSALEELASQTLSRVANAEGASWKAMYLDGF
FT                   SGDAVTRIAATARALLEEDDVIRAILERTEEEHLRKLMNQPTLDEEQFPDREEARRMRY
FT                   RAEKDAEPLAERLWAMRNSAAQLAQSGARAQARTMLEEAYTMRIDDVAKRREASGLDPA
FT                   PPGSVAPEALPELLALEECFRGEPSWDKELAGVRGQVLKAVRAAAARSLAMNDAKRAAA
FT                   LLEGAAREYGSDRKLGATHVSVAKTRDAADEAWRAAGIEADDEEAKDAALAVVAGTPVP
FT                   RGQGGGIVMKLGKTYLEELEIRRK"
     MQAPWVRPST RSVGVTSTPR ARCAVASSST RATGEPSPRR CAPDRRGGAR DGRTTTIFSA        60
     TTAIVPLAVA PPRRSTGRRG ADFSRRGPVS LRARRARFAV VPDAGDGETV PGGGDDDGTS       120
     DDSDPSSANQ GDDRGGIVDE ATEETEEEDE EDEYEEVEVE VDYTVLDHAR DAIDSLGTWS       180
     DVAGWGDDQS VTNRETSRGV GGAAGTSSFK SAATAPVSAA PGGKLGMAPT DGVVVALAFT       240
     IGALFGRRQA EAGGASRGLA ELVKSGNGGA VPGGVELRPM TEEERIADEK RRAERRAEKE       300
     RREAEATKKR KEDEAKFLAA EKKRLEKEAA EAERVRVAEE ERRAKVRAEL AERAEIERAI       360
     REEKEAKERE ERERREREAE EELRKRREEE ARVAAERLAA MNAEKERRGE TLKGFDVAAS       420
     VTYEYRAGAG DVEVEVRARC GISSPATISD AFPTSEKARR GALEMCSAVA KSAVANFASD       480
     QRVRRMTGET DRCLIGVDPV TGAGFDDAEF DHWMRVSQAR TDAELRTLVM RGGAAMELKI       540
     RQPGGASNNQ RETSELEFRP ERASLPSADA DNVANRLTAA AAAALDNAYG VATEDLDWVA       600
     RYELSALHGL DASLCFPAVS EGDGDKNRLK GTVTATMLTL SHWIARAKMN LASAGDAGPG       660
     LAAVSALEEL ASQTLSRVAN AEGASWKAMY LDGFSGDAVT RIAATARALL EEDDVIRAIL       720
     ERTEEEHLRK LMNQPTLDEE QFPDREEARR MRYRAEKDAE PLAERLWAMR NSAAQLAQSG       780
     ARAQARTMLE EAYTMRIDDV AKRREASGLD PAPPGSVAPE ALPELLALEE CFRGEPSWDK       840
     ELAGVRGQVL KAVRAAAARS LAMNDAKRAA ALLEGAAREY GSDRKLGATH VSVAKTRDAA       900
     DEAWRAAGIE ADDEEAKDAA LAVVAGTPVP RGQGGGIVMK LGKTYLEELE IRRK             954
//

If you have problems or comments...

PBIL Back to PBIL home page