(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE192

MICSR_1.PE192        Location/Qualifiers
FT   CDS             386448..387974
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636532"
FT                   /orf_name="MICPUN_56765"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61686.1"
FT                   /db_xref="UniParc:UPI000199A9EF"
FT                   /db_xref="UniProtKB/TrEMBL:C1E169"
FT                   /transl_table=1
FT                   /translation="MSDPIGFGELGELGRTLDEDMMMNSAVFDGALDAIYSKFDLGNPD
FT                   DLASLYGVSPGAPDVRDVRVPAQTGTGTGTGSGDGSGDGSGAFNPKIDGKAETTSTAVG
FT                   KRGRANLNQAEVQKRYRERKKNRMLDLEKQVEDLREKVKELEREKARRGDGTDLKEASG
FT                   SGNSTPPDAATTTTEGGRSSDDDTTTLLRPFAVAPGDGDPEFTERMLREDAARRSRDSK
FT                   GLKTDSGDGSGCEGHLTFIIEASEALKRGVDGPSATGKFKNYTEAEIWWGGVTEVYNKA
FT                   VRNIRDLVDVGANDSNLRSAIDAISNVVSVARESRSELAVISTMTRSAENMEKDAASKG
FT                   LDLRAACRTSCALLAKSVVDASMQSQNTQEVLTKLQNELPPKDLEIIVDWFESYTDEFQ
FT                   RIGMVRYSMIQKYEHTKLTADVPHTVYGIPASEVTKEEGPYAEDSRVIMDSLRKEMLMY
FT                   KDGIQDLLQQLPVRSAAQLYLSAFPSAPDPLSLALELKKKLRPESKATSE"
     MSDPIGFGEL GELGRTLDED MMMNSAVFDG ALDAIYSKFD LGNPDDLASL YGVSPGAPDV        60
     RDVRVPAQTG TGTGTGSGDG SGDGSGAFNP KIDGKAETTS TAVGKRGRAN LNQAEVQKRY       120
     RERKKNRMLD LEKQVEDLRE KVKELEREKA RRGDGTDLKE ASGSGNSTPP DAATTTTEGG       180
     RSSDDDTTTL LRPFAVAPGD GDPEFTERML REDAARRSRD SKGLKTDSGD GSGCEGHLTF       240
     IIEASEALKR GVDGPSATGK FKNYTEAEIW WGGVTEVYNK AVRNIRDLVD VGANDSNLRS       300
     AIDAISNVVS VARESRSELA VISTMTRSAE NMEKDAASKG LDLRAACRTS CALLAKSVVD       360
     ASMQSQNTQE VLTKLQNELP PKDLEIIVDW FESYTDEFQR IGMVRYSMIQ KYEHTKLTAD       420
     VPHTVYGIPA SEVTKEEGPY AEDSRVIMDS LRKEMLMYKD GIQDLLQQLP VRSAAQLYLS       480
     AFPSAPDPLS LALELKKKLR PESKATSE                                          508
//

If you have problems or comments...

PBIL Back to PBIL home page