(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE193

MICSR_1.PE193        Location/Qualifiers
FT   CDS             join(complement(390489..391526),complement(390246..390311),
FT                   complement(389410..389981),complement(388071..389274))
FT                   /codon_start=1
FT                   /gene_family="HOG000250411" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636533"
FT                   /orf_name="MICPUN_93660"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="ACO62119.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="HOGENOM:HBG402483"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="InterPro:IPR018973"
FT                   /db_xref="UniParc:UPI000199A9F0"
FT                   /db_xref="UniProtKB/TrEMBL:C1E170"
FT                   /transl_table=1
FT                   /translation="MRDSEEEKRATEEKRATSTTLNDDDLWSRVNAAPVSAFLAVAEAE
FT                   RRRNGVAPPLIREETVARAKRGGRGGGRKKGRAACRCHGLEQLDVDAFIAHLTIGPDSL
FT                   GGKGQCEHRLDVPARPTRLAPEGSPPPALRPATVAALVASGVPLHDADHARLRLFSHQH
FT                   EGICAALRGKNVCVATGTASGKSVCYNAPVLDSLLHDPDATALYLFPTKALAQDQIRAL
FT                   RVMLDGAATYLGDHAAPIDVGVYDGDTPETERTRVRAECRLVITNPDMLHVGLLPQYKR
FT                   WARVFKGLKYVVLDEAHVYRGVFGSHVSLVVRRLRRISRELYGSDPRFIVTSATIANPR
FT                   EHAVDLWEVIDVDGSPSGEKTFLMWNPPAPRSSPIVEVAALLAECVRHDLKCIAFCKTK
FT                   KLCELVLRYCREILRDTGAGHLADSVAAYRGGYAAVDRRAVEGALFGGALRGVAATNAL
FT                   ELGVDVGYLDCTLHLGFPGTVASLVQQSGRAGRRGRRALGVYVAFDGPLDQYFMRDPAR
FT                   LFERPIERAAVDPQNFKIMRAHAQCAAHEIPLDPRVAEDNRPGGGGGGGGGGPAPDARL
FT                   VWCGGLVSDGERGPANGVSIRTIEEERYRIVDEASGRVIEEVEASKAFWEVYPGAVYLN
FT                   QARTYLCKSLDVESRTARVRLADVKYFTGTVDATTVTLVQHGSQRHAYPHRPGPAHRRP
FT                   QFPGTTAQCAECEIKVTFSAYHKIWQGTGRVFDTVSLNLPDVTYKTRAAWIRVPDGARR
FT                   ECEESGVDFRAGVHAATHAMINALPLFLMVNQSDVGAECDDPQRGHYKPTRILIFDRQP
FT                   GGVGIAERAAPVFPRLLRAAIELIEECRDCRGDRAGVAKGTGPDPPGDGSRGRREADGE
FT                   GGPDSASQTPASQTPRDQSGCPGCVHYLACDVYNVSLDRLAALVVLRSIVNAEEGTFGS
FT                   FEDAAGSDLTAAGDGRGCCANGRHGNVGA"
     MRDSEEEKRA TEEKRATSTT LNDDDLWSRV NAAPVSAFLA VAEAERRRNG VAPPLIREET        60
     VARAKRGGRG GGRKKGRAAC RCHGLEQLDV DAFIAHLTIG PDSLGGKGQC EHRLDVPARP       120
     TRLAPEGSPP PALRPATVAA LVASGVPLHD ADHARLRLFS HQHEGICAAL RGKNVCVATG       180
     TASGKSVCYN APVLDSLLHD PDATALYLFP TKALAQDQIR ALRVMLDGAA TYLGDHAAPI       240
     DVGVYDGDTP ETERTRVRAE CRLVITNPDM LHVGLLPQYK RWARVFKGLK YVVLDEAHVY       300
     RGVFGSHVSL VVRRLRRISR ELYGSDPRFI VTSATIANPR EHAVDLWEVI DVDGSPSGEK       360
     TFLMWNPPAP RSSPIVEVAA LLAECVRHDL KCIAFCKTKK LCELVLRYCR EILRDTGAGH       420
     LADSVAAYRG GYAAVDRRAV EGALFGGALR GVAATNALEL GVDVGYLDCT LHLGFPGTVA       480
     SLVQQSGRAG RRGRRALGVY VAFDGPLDQY FMRDPARLFE RPIERAAVDP QNFKIMRAHA       540
     QCAAHEIPLD PRVAEDNRPG GGGGGGGGGP APDARLVWCG GLVSDGERGP ANGVSIRTIE       600
     EERYRIVDEA SGRVIEEVEA SKAFWEVYPG AVYLNQARTY LCKSLDVESR TARVRLADVK       660
     YFTGTVDATT VTLVQHGSQR HAYPHRPGPA HRRPQFPGTT AQCAECEIKV TFSAYHKIWQ       720
     GTGRVFDTVS LNLPDVTYKT RAAWIRVPDG ARRECEESGV DFRAGVHAAT HAMINALPLF       780
     LMVNQSDVGA ECDDPQRGHY KPTRILIFDR QPGGVGIAER AAPVFPRLLR AAIELIEECR       840
     DCRGDRAGVA KGTGPDPPGD GSRGRREADG EGGPDSASQT PASQTPRDQS GCPGCVHYLA       900
     CDVYNVSLDR LAALVVLRSI VNAEEGTFGS FEDAAGSDLT AAGDGRGCCA NGRHGNVGA        959
//

If you have problems or comments...

PBIL Back to PBIL home page