(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE194

MICSR_1.PE194        Location/Qualifiers
FT   CDS             393339..394739
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636534"
FT                   /orf_name="MICPUN_56767"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61687.1"
FT                   /db_xref="HOGENOM:HBG560044"
FT                   /db_xref="InterPro:IPR001602"
FT                   /db_xref="UniParc:UPI000199A9F1"
FT                   /db_xref="UniProtKB/TrEMBL:C1E171"
FT                   /transl_table=1
FT                   /translation="MAKTSATSTAPNDAPASSPAAGGDGWTQRVLTLNPKRRGIFIWTD
FT                   ALRKNVPEIASCKAGVLNLFLRSTTAALSVNENADPDVRTDLENALDRVVPGTDVLDAT
FT                   ARSAFVGVSLDVPVQGGKLALGTWQGLYLCEWADGAEPCQVVATLVDASDDVRCTRNVT
FT                   VRAPRRGCHLVQDEVDDAFKPARDRTFKPDRTNKPGLANLLIRHTSASLTLNENADPTA
FT                   RGDLENALNRIVPEEWHSTLFSHVEEGPDDMTAHVKSTLLGCSLTVPVDAHGAMKTGTW
FT                   QGVYLCEHRNVGGMGVGHAREVATTLIDGAGVANTAGQTTVTLTAPGRGCHDVTAEIAA
FT                   AAKAIGVGSNVRTGWLNVFVQHTSASLAVCDSTLAGAGDRLERALNETVPESWNDEFFV
FT                   HTYEGPDDMPGHVKASIVGCSVTVPIVDGELGLGKAQGLFLCEHRDAGGYGCNLNRKVV
FT                   LTLQGVDK"
     MAKTSATSTA PNDAPASSPA AGGDGWTQRV LTLNPKRRGI FIWTDALRKN VPEIASCKAG        60
     VLNLFLRSTT AALSVNENAD PDVRTDLENA LDRVVPGTDV LDATARSAFV GVSLDVPVQG       120
     GKLALGTWQG LYLCEWADGA EPCQVVATLV DASDDVRCTR NVTVRAPRRG CHLVQDEVDD       180
     AFKPARDRTF KPDRTNKPGL ANLLIRHTSA SLTLNENADP TARGDLENAL NRIVPEEWHS       240
     TLFSHVEEGP DDMTAHVKST LLGCSLTVPV DAHGAMKTGT WQGVYLCEHR NVGGMGVGHA       300
     REVATTLIDG AGVANTAGQT TVTLTAPGRG CHDVTAEIAA AAKAIGVGSN VRTGWLNVFV       360
     QHTSASLAVC DSTLAGAGDR LERALNETVP ESWNDEFFVH TYEGPDDMPG HVKASIVGCS       420
     VTVPIVDGEL GLGKAQGLFL CEHRDAGGYG CNLNRKVVLT LQGVDK                      466
//

If you have problems or comments...

PBIL Back to PBIL home page