(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE195

MICSR_1.PE195        Location/Qualifiers
FT   CDS             join(complement(395293..395436),complement(395142..395215),
FT                   complement(394850..395063))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636535"
FT                   /orf_name="MICPUN_56768"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62120.1"
FT                   /db_xref="UniParc:UPI000199A9F2"
FT                   /db_xref="UniProtKB/TrEMBL:C1E172"
FT                   /transl_table=1
FT                   /translation="MPTYGTHTPDVKYVPSSLMAFGYKGVKPVPGVPNMYLKDYQDNLF
FT                   EMDIKDGAAGVSNCNFHWNDCDIAPRFGNHEDRVADKDIKYRPNVANICPRPKDWKPGK
FT                   YQSKGVDGVDVNYPRIDERNRKYWGSAGGSHAKTFPSDE"
     MPTYGTHTPD VKYVPSSLMA FGYKGVKPVP GVPNMYLKDY QDNLFEMDIK DGAAGVSNCN        60
     FHWNDCDIAP RFGNHEDRVA DKDIKYRPNV ANICPRPKDW KPGKYQSKGV DGVDVNYPRI       120
     DERNRKYWGS AGGSHAKTFP SDE                                               143
//

If you have problems or comments...

PBIL Back to PBIL home page