(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE196

MICSR_1.PE196        Location/Qualifiers
FT   CDS             complement(395586..398315)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636536"
FT                   /orf_name="MICPUN_99353"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62121.1"
FT                   /db_xref="InterPro:IPR003409"
FT                   /db_xref="UniParc:UPI000199A9F3"
FT                   /db_xref="UniProtKB/TrEMBL:C1E173"
FT                   /transl_table=1
FT                   /translation="MKRKAPASPPPGRDDVTVETFVHEDFAGRYDGEVDDEGRPHGAGI
FT                   LRLDDDGAWYEGEFRRGARHGQGTLHFPPDDDDDDDEDEDEDHDRKHGPMPETSLEGLS
FT                   TRGDRVVGSFADDAIEGYAEYLSSDGTRRAGLWHDGELSGLIEEFDEDGECVFGGEMDA
FT                   DGNKNGRGWFSFPDGGCYGGQLAAGKPDGKGLYLFPLTYGVCPPESKLAAATFAFWGMY
FT                   QSETKEWEAWDHRRDQAELEWQKVADGKRCPTSLAAKPDLEKDWRDEEPGPWSESPEMC
FT                   GDDPEPPAGMPERMCMYGEWVGGKCVRAGFYEGFGFWKEHFWAQPHLSPLLADIFMCFF
FT                   ELGHTEGHGEERYAIAKAAGLSMRDEIEKFQLYSTEQGCHMPNNSEGPWGVVKAGADSY
FT                   SGEKPRNHEPGELLGFVSGRRRALRGGWGERRWLPSDKIFFLGDDDGAPDPPAEGSGAD
FT                   PDGGSGAGGVFIIADDTDPVPGEAKVPDYDSEGDEKTFLTNIDVPLKRKDGSRRRIYTT
FT                   LGEHAKVVVRDPPNCERRPYVHPVLGNILALVATRKITRDEDITVPPCYDTGWRLNPRT
FT                   EAGYYYHLKNSPPAELFESGRGGEAGVGKVYVRAHGPWRALWLDKVEQGLAYDFNAGKA
FT                   YAEDPAFVDFKHDPAVLGFEYVRAMATAAVAAIGANALNARTRALCVGLGAGALPAFLS
FT                   RVVGLDVLCVEIDADVADAARNFLGVDFRETNPDDAFDVFNERSTLNDDRLSAARGSGF
FT                   GLVIEDIADFLDRDECAGSFDVVLLDAYDGEGRVPAHLRDPENKFVQKVLGSVRPNSGC
FT                   IVANLWNSEDRAEFSRERRELEEFRKQLAAGGASARADVTVSGQENNVVVLAASGAAGG
FT                   GHLASGALRRSLVEIVKAHPGVGASLVPPEHFAATEPY"
     MKRKAPASPP PGRDDVTVET FVHEDFAGRY DGEVDDEGRP HGAGILRLDD DGAWYEGEFR        60
     RGARHGQGTL HFPPDDDDDD DEDEDEDHDR KHGPMPETSL EGLSTRGDRV VGSFADDAIE       120
     GYAEYLSSDG TRRAGLWHDG ELSGLIEEFD EDGECVFGGE MDADGNKNGR GWFSFPDGGC       180
     YGGQLAAGKP DGKGLYLFPL TYGVCPPESK LAAATFAFWG MYQSETKEWE AWDHRRDQAE       240
     LEWQKVADGK RCPTSLAAKP DLEKDWRDEE PGPWSESPEM CGDDPEPPAG MPERMCMYGE       300
     WVGGKCVRAG FYEGFGFWKE HFWAQPHLSP LLADIFMCFF ELGHTEGHGE ERYAIAKAAG       360
     LSMRDEIEKF QLYSTEQGCH MPNNSEGPWG VVKAGADSYS GEKPRNHEPG ELLGFVSGRR       420
     RALRGGWGER RWLPSDKIFF LGDDDGAPDP PAEGSGADPD GGSGAGGVFI IADDTDPVPG       480
     EAKVPDYDSE GDEKTFLTNI DVPLKRKDGS RRRIYTTLGE HAKVVVRDPP NCERRPYVHP       540
     VLGNILALVA TRKITRDEDI TVPPCYDTGW RLNPRTEAGY YYHLKNSPPA ELFESGRGGE       600
     AGVGKVYVRA HGPWRALWLD KVEQGLAYDF NAGKAYAEDP AFVDFKHDPA VLGFEYVRAM       660
     ATAAVAAIGA NALNARTRAL CVGLGAGALP AFLSRVVGLD VLCVEIDADV ADAARNFLGV       720
     DFRETNPDDA FDVFNERSTL NDDRLSAARG SGFGLVIEDI ADFLDRDECA GSFDVVLLDA       780
     YDGEGRVPAH LRDPENKFVQ KVLGSVRPNS GCIVANLWNS EDRAEFSRER RELEEFRKQL       840
     AAGGASARAD VTVSGQENNV VVLAASGAAG GGHLASGALR RSLVEIVKAH PGVGASLVPP       900
     EHFAATEPY                                                               909
//

If you have problems or comments...

PBIL Back to PBIL home page