(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE197

MICSR_1.PE197        Location/Qualifiers
FT   CDS             398943..399830
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636537"
FT                   /orf_name="MICPUN_107886"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61688.1"
FT                   /db_xref="UniParc:UPI000199A9F4"
FT                   /db_xref="UniProtKB/TrEMBL:C1E174"
FT                   /transl_table=1
FT                   /translation="MWRRMAWEKFGREWFDACETDESILYYEHPQPNHDKWYLRLRDRE
FT                   TVVQDNGMYEITTITEYGHEAEEYRASKKMPAGATECEWAGRKYKLHNYSPPPICVDST
FT                   KEISFKLHLKCIWDVVEAAWNMMCDEVDVPSYADVRRFFYRPGQIMSMSEPECWYDDED
FT                   GEPNDRKYDRETTIQAAKEFCGNLLGLMMKHFEGADHVLRKCDWPEGEDWTDMRKEEYS
FT                   EAFKEVVDKQCEVRDGRSWSLIPLLHDKRTRVVDMLVDRIGGFRYKEGIVRTLKVLDGF
FT                   KMIDGVVTNTSIHG"
     MWRRMAWEKF GREWFDACET DESILYYEHP QPNHDKWYLR LRDRETVVQD NGMYEITTIT        60
     EYGHEAEEYR ASKKMPAGAT ECEWAGRKYK LHNYSPPPIC VDSTKEISFK LHLKCIWDVV       120
     EAAWNMMCDE VDVPSYADVR RFFYRPGQIM SMSEPECWYD DEDGEPNDRK YDRETTIQAA       180
     KEFCGNLLGL MMKHFEGADH VLRKCDWPEG EDWTDMRKEE YSEAFKEVVD KQCEVRDGRS       240
     WSLIPLLHDK RTRVVDMLVD RIGGFRYKEG IVRTLKVLDG FKMIDGVVTN TSIHG            295
//

If you have problems or comments...

PBIL Back to PBIL home page