(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE198

MICSR_1.PE198        Location/Qualifiers
FT   CDS             400211..404140
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636538"
FT                   /orf_name="MICPUN_56771"
FT                   /product="Kinesin-like protein"
FT                   /function="ATP binding"
FT                   /function="microtubule motor activity"
FT                   /biological_process="microtubule-based movement "
FT                   /protein_id="ACO61689.1"
FT                   /db_xref="GO:0003777"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0007018"
FT                   /db_xref="InterPro:IPR001752"
FT                   /db_xref="UniParc:UPI000199AA56"
FT                   /db_xref="UniProtKB/TrEMBL:C1E175"
FT                   /transl_table=1
FT                   /translation="MPTRGAGARKVRPEGQNMRTVVQLLTAGNKNLRRDVSVASRHVSL
FT                   IRPGYTEAQTDDTYEVDDCFGSDLGNTEAYKRVLHPAVKQVIDGFNSSCITIGCSGSGK
FT                   TTLLHGRTSGDGIVRLAIKALFEGLHNKAAQVGLLLSQHKAQGGGGQSMEFAVDASFCE
FT                   VYEEKVRDLFAAARDAEAAGGKDSVKTEYLEVEETADDGWHVAGLSHRSAPDAASLQTA
FT                   YAGALNHRVTGLSEYGHSKHDRAASVLTLKVSQYIPGLPNATGEIAPAQHIVSTIVIAD
FT                   NPGAEPLAMDPAVLRLREGARLNKAITALAGVVRALATQRREFAGHGDSVLTKILSEPL
FT                   GGNCATTILGTLKLGEWERSSAVMDLVGHARRAPCFPVVQDDAARGLQQRLRSRLLQIN
FT                   DARETYRDQIQSTGADGIDPNNIGLQMAKLHELEGQLLNERGDKAELLAEKEALIERLQ
FT                   RLNGMDKANLAEKEELQKALIASEEDRLEIARALVEAQLEANEAALQAEKTRHELVERV
FT                   HELEARAIASEVRVKGAEQSYGELQNKAGSLNVENQRIKEELDQTRQELEKELKEIRTE
FT                   HAEVSGEVSSLKAANEDLSAELEDFRRKINVERRRAEDAESERDEFRANQEMYQSNMQK
FT                   KVEAAERMAEEAVKVAEETKNRLVQAAKAERDEAVAAARASKDKAVQAAQEERDEEVAK
FT                   ARSARDRAIDEMRMEKEKAVFEARKEKDEAVALANAEKAERTAYLENDRDTRVAKAEKD
FT                   KDEAIAKALRERDEAVTEAKRRSSEAIAAAQEDKDAAIAEAHRLRDLAQERLKFETERL
FT                   GSIANEANGSIQGVTRAMEEARSAERMARREADRAVGEMTQLREKLENVRAEFSQRLKE
FT                   YMLQVGDLERGAQVLATDPNADHVLRPSQLYEAAQTLALDLHRASADQVTEYRRVTEDL
FT                   QQRLTRAQRDVRALHAGYRTLRHRFEDVAPETVDEKGKAAVPHEDDLVGTPPTPAEARE
FT                   MDARGLAQKLADLRDENAALQKELRMAALDGRGPLAPHNVRAAKEAAARGGGSRPGTGE
FT                   DGEIAYYNDGNKQDRDGGFGQVGKGEIVVKKNAPDDSFGGAMAGAGENARLRAENARLQ
FT                   KTIDELKHRRPSTTEEDMRAEVSKLRIQLHALSNQDNTRAKLTQEISVLKIQLQERTQE
FT                   LKEHKNHSQREAFKQQKAAIKEFTDRVQSELEKENRALQTRAAMAEEQIKEINAYMAQS
FT                   TLAYQKEIMRLRTIIQATAPERLRSPVNPGLMGSKTQDRSGAGGAQPHQREGRGDKGGG
FT                   VRASGGWDRSTKPSEPLRPRSNNGA"
     MPTRGAGARK VRPEGQNMRT VVQLLTAGNK NLRRDVSVAS RHVSLIRPGY TEAQTDDTYE        60
     VDDCFGSDLG NTEAYKRVLH PAVKQVIDGF NSSCITIGCS GSGKTTLLHG RTSGDGIVRL       120
     AIKALFEGLH NKAAQVGLLL SQHKAQGGGG QSMEFAVDAS FCEVYEEKVR DLFAAARDAE       180
     AAGGKDSVKT EYLEVEETAD DGWHVAGLSH RSAPDAASLQ TAYAGALNHR VTGLSEYGHS       240
     KHDRAASVLT LKVSQYIPGL PNATGEIAPA QHIVSTIVIA DNPGAEPLAM DPAVLRLREG       300
     ARLNKAITAL AGVVRALATQ RREFAGHGDS VLTKILSEPL GGNCATTILG TLKLGEWERS       360
     SAVMDLVGHA RRAPCFPVVQ DDAARGLQQR LRSRLLQIND ARETYRDQIQ STGADGIDPN       420
     NIGLQMAKLH ELEGQLLNER GDKAELLAEK EALIERLQRL NGMDKANLAE KEELQKALIA       480
     SEEDRLEIAR ALVEAQLEAN EAALQAEKTR HELVERVHEL EARAIASEVR VKGAEQSYGE       540
     LQNKAGSLNV ENQRIKEELD QTRQELEKEL KEIRTEHAEV SGEVSSLKAA NEDLSAELED       600
     FRRKINVERR RAEDAESERD EFRANQEMYQ SNMQKKVEAA ERMAEEAVKV AEETKNRLVQ       660
     AAKAERDEAV AAARASKDKA VQAAQEERDE EVAKARSARD RAIDEMRMEK EKAVFEARKE       720
     KDEAVALANA EKAERTAYLE NDRDTRVAKA EKDKDEAIAK ALRERDEAVT EAKRRSSEAI       780
     AAAQEDKDAA IAEAHRLRDL AQERLKFETE RLGSIANEAN GSIQGVTRAM EEARSAERMA       840
     RREADRAVGE MTQLREKLEN VRAEFSQRLK EYMLQVGDLE RGAQVLATDP NADHVLRPSQ       900
     LYEAAQTLAL DLHRASADQV TEYRRVTEDL QQRLTRAQRD VRALHAGYRT LRHRFEDVAP       960
     ETVDEKGKAA VPHEDDLVGT PPTPAEAREM DARGLAQKLA DLRDENAALQ KELRMAALDG      1020
     RGPLAPHNVR AAKEAAARGG GSRPGTGEDG EIAYYNDGNK QDRDGGFGQV GKGEIVVKKN      1080
     APDDSFGGAM AGAGENARLR AENARLQKTI DELKHRRPST TEEDMRAEVS KLRIQLHALS      1140
     NQDNTRAKLT QEISVLKIQL QERTQELKEH KNHSQREAFK QQKAAIKEFT DRVQSELEKE      1200
     NRALQTRAAM AEEQIKEINA YMAQSTLAYQ KEIMRLRTII QATAPERLRS PVNPGLMGSK      1260
     TQDRSGAGGA QPHQREGRGD KGGGVRASGG WDRSTKPSEP LRPRSNNGA                  1309
//

If you have problems or comments...

PBIL Back to PBIL home page