(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE199

MICSR_1.PE199        Location/Qualifiers
FT   CDS             404237..405268
FT                   /codon_start=1
FT                   /gene_family="HOG000100023" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636539"
FT                   /orf_name="MICPUN_56772"
FT                   /product="Predicted protein"
FT                   /function="ATP-dependent peptidase activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="ACO61690.1"
FT                   /db_xref="GO:0004176"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="HOGENOM:HBG560049"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="UniParc:UPI000199AA57"
FT                   /db_xref="UniProtKB/TrEMBL:C1E176"
FT                   /transl_table=1
FT                   /translation="MIATPMTATAPTRAIVSSTSIRRAIRPARVLGAPARRCRHTTLAT
FT                   SDSSDPAEGKGKEGAEEGDGISLDDLRILQQRVESIREREAKMDVLQLLVLDASVPGQV
FT                   LPLQFDAGGDPRRPLNGGTYVGEDVNLGDRFGMLGQAPSNGQILPNGVEVTVTRVLLKP
FT                   DGSSMVELTAGRRFKVHGQPFEDPDNDDAPSGRVVWIDPDLGAGEQTVEGADPALVHPE
FT                   APAPRDPATYDEESERLCRELPALVSTWRALVRDTGRERQPNQLELIEKHLGPQPGVSK
FT                   PARLACWVAGLINPIPALGVAYEIRPAMLMATTVGDMIGVAHKGISLSIKGLRKSAGDV
FT                   DAE"
     MIATPMTATA PTRAIVSSTS IRRAIRPARV LGAPARRCRH TTLATSDSSD PAEGKGKEGA        60
     EEGDGISLDD LRILQQRVES IREREAKMDV LQLLVLDASV PGQVLPLQFD AGGDPRRPLN       120
     GGTYVGEDVN LGDRFGMLGQ APSNGQILPN GVEVTVTRVL LKPDGSSMVE LTAGRRFKVH       180
     GQPFEDPDND DAPSGRVVWI DPDLGAGEQT VEGADPALVH PEAPAPRDPA TYDEESERLC       240
     RELPALVSTW RALVRDTGRE RQPNQLELIE KHLGPQPGVS KPARLACWVA GLINPIPALG       300
     VAYEIRPAML MATTVGDMIG VAHKGISLSI KGLRKSAGDV DAE                         343
//

If you have problems or comments...

PBIL Back to PBIL home page